Os01t0109000-01

Locus

Os01g0109000

Description

Similar to Late embryogenesis abundant protein, group 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK120074 (DDBJ, Best hit)

Protein Evidence

A2Y720 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J013007J15 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0109000-01)

Transcript

1458 bp

>Os01t0109000-01 Similar to Late embryogenesis abundant protein, group 3.
acctctctcctcttcctttctctcaccgagcagggcaaccgacgggtgtggggaggagac
cggtgggggaggcgggagacgggactccggcggtcggcgacgggcgacgaggcggcggcg
gcgacgacgcgggagcaggagggcctccccccacgccgccgccggcgGAGGAACGCAGTG
AGCTGCCTTAGGTGGGCTCTCCGGAGGAAGTCGGCGGCGGTGTGACGGCACATGCGGCGA
AGGACAAGACCTCCGGCACGGCGTaggcggcgagggacaaggccgccgagagcaaggacc
agactagcggcttcctcggcgagaagaccgagaaggccaagcagaaggccaccgagaccg
acgagacggcgcggtggagggttctgcatcggctccctgcacctgtcccaatttccatgC
CGGCTGCCTTTTGTTATATTCTAATCATCGTTTTTGTTTATCAAATCAATTTTTGAACAC
AACCTTTTTTACTGAAGGATGATGAAACAATGCACAAGATCGTCTTCAGTAATCAGTAGT
TCAGTGGCTGGAAGTTTGCGTGCAGCCTGTTGCGCTTGCACCCAGTGAACGTGCACGAGT
ACCGCCGCTCCAGCTGCTGCTTGTCCTTACCACCGCCGCCGGCGGCTTTGTCAGCATGGG
CACGCTCTTGTACTTGTCACTGTGTCTACGCATGTGCATCTGTAGGTTCGCGTCCCGCTT
GAGCCACTTGACGCAGATGGATCAGAAGCGCGTGTGCTGCATCAGGATTTCATCCTCCTC
CGCCGGCGCCGCCAAGCAGAAGACCACCGAGACGGCGTAGTACACCAAGGAATCCGCCGT
CGCTGGCAAGGACAAGACCGGTAGCGTCCTCCAACAAGCGAGTGAGCAGGTGAAGAGCAC
GGTGGTCGGCGCCAAGGACGCGGTGATGAACACGCTGGGATGACCGGAGACAAGGCCGTC
AGCCTATGGTGGCAGCAGCAGTGGCTCACATcgacggcacacccaaggggatccgcggat
ggacgacggcggcaacgcgtcaccatcgtcctcgctctccagcgtcggcgcggcttgccc
tccagcgtcgcagcttccgccatcgccgcctcgtcgcccgctgcctcctcctctcccgcc
tcgccccgacgacctctccccacccgccgggcggcttgccgcttgcagttgcagagaagg
agaaaagtgagagagagagagagaggagggatggagaggaaatggaagagagagggtgct
gacgtggcatcctgacatgtgggttccacgctgagtcagccgtcacgtcggacaaaaccg
tagtcaaaaccaccgatggatctaatttgcactggttttgtaagttggaggatgcgttgt
atccagttttgtggttggaggacgattttgtaattcgatgacaagttaagggatcttcgg
ggtactttttccTTTTGC

CDS

267 bp

>Os01t0109000-01 Similar to Late embryogenesis abundant protein, group 3.
CCGGAGACAAGGCCGTCAGCCTATGGTGGCAGCAGCAGTGGCTCACATcgacggcacacc
caaggggatccgcggatggacgacggcggcaacgcgtcaccatcgtcctcgctctccagc
gtcggcgcggcttgccctccagcgtcgcagcttccgccatcgccgcctcgtcgcccgctg
cctcctcctctcccgcctcgccccgacgacctctccccacccgccgggcggcttgccgct
tgcagttgcagagaaggagaaaagtga

Protein

89 aa

>Os01t0109000-01 Similar to Late embryogenesis abundant protein, group 3.
PETRPSAYGGSSSGSHRRHTQGDPRMDDGGNASPSSSLSSVGAACPPASQLPPSPPRRPL
PPPLPPRPDDLSPPAGRLAACSCREGEK*

5'UTR

chr01:496377..497253 (- strand) : 877 bp

chr01:496226..496291 (- strand) : 66 bp

CDS

chr01:495959..496225 (- strand) : 267 bp

3'UTR

chr01:495711..495958 (- strand) : 248 bp

FASTA

>Os01t0109000-01 class=Sequence position=chr01:495711..497253 (- strand)
acctctctcc tcttcctttc tctcaccgag cagggcaacc gacgggtgtg gggaggagac cggtggggga ggcgggagac
gggactccgg cggtcggcga cgggcgacga ggcggcggcg gcgacgacgc gggagcagga gggcctcccc ccacgccgcc
gccggcgGAG GAACGCAGTG AGCTGCCTTA GGTGGGCTCT CCGGAGGAAG TCGGCGGCGG TGTGACGGCA CATGCGGCGA
AGGACAAGAC CTCCGGCACG GCGTaggcgg cgagggacaa ggccgccgag agcaaggacc agactagcgg cttcctcggc
gagaagaccg agaaggccaa gcagaaggcc accgagaccg acgagacggc gcggtggagg gttctgcatc ggctccctgc
acctgtccca atttccatgC CGGCTGCCTT TTGTTATATT CTAATCATCG TTTTTGTTTA TCAAATCAAT TTTTGAACAC
AACCTTTTTT ACTGAAGGAT GATGAAACAA TGCACAAGAT CGTCTTCAGT AATCAGTAGT TCAGTGGCTG GAAGTTTGCG
TGCAGCCTGT TGCGCTTGCA CCCAGTGAAC GTGCACGAGT ACCGCCGCTC CAGCTGCTGC TTGTCCTTAC CACCGCCGCC
GGCGGCTTTG TCAGCATGGG CACGCTCTTG TACTTGTCAC TGTGTCTACG CATGTGCATC TGTAGGTTCG CGTCCCGCTT
GAGCCACTTG ACGCAGATGG ATCAGAAGCG CGTGTGCTGC ATCAGGATTT CATCCTCCTC CGCCGGCGCC GCCAAGCAGA
AGACCACCGA GACGGCGTAG TACACCAAGG AATCCGCCGT CGCTGGCAAG GACAAGACCG GTAGCGTCCT CCAACAAGTA
CACACCATTA GCAACCTCGG TTAATTTCTC CTTGTCGAAC ACCATTGTTG TGGATTTTGA GGAGAATTCG TTTGTGTTTC
AGGCGAGTGA GCAGGTGAAG AGCACGGTGG TCGGCGCCAA GGACGCGGTG ATGAACACGC TGGGATGACC GGAGACAAGG
CCGTCAGCCT ATGGTGGCAG CAGCAGTGGC TCACATcgac ggcacaccca aggggatccg cggatggacg acggcggcaa
cgcgtcacca tcgtcctcgc tctccagcgt cggcgcggct tgccctccag cgtcgcagct tccgccatcg ccgcctcgtc
gcccgctgcc tcctcctctc ccgcctcgcc ccgacgacct ctccccaccc gccgggcggc ttgccgcttg cagttgcaga
gaaggagaaa agtgagagag agagagagag gagggatgga gaggaaatgg aagagagagg gtgctgacgt ggcatcctga
catgtgggtt ccacgctgag tcagccgtca cgtcggacaa aaccgtagtc aaaaccaccg atggatctaa tttgcactgg
ttttgtaagt tggaggatgc gttgtatcca gttttgtggt tggaggacga ttttgtaatt cgatgacaag ttaagggatc
ttcggggtac tttttccTTT TGC