Os01t0110050-01

Locus

Os01g0110050

Description

Pi homeostasis

RAP-DB Gene Symbol Synonym(s)

PHO1;1 CIS-NAT, OsPHO1;1 cis-NAT

RAP-DB Gene Name Synonym(s)

PHOSPHATE TRANSPORTER 1;1 CIS-NATURAL ANTISENSE TRANSCRIPT

CGSNL Gene Symbol

PHO1;1 CIS-NAT

CGSNL Gene Name

PHOSPHATE TRANSPORTER 1;1 CIS-NATURAL ANTISENSE TRANSCRIPT

Oryzabase Gene Symbol Synonym(s)

OsPHO1;1 cis-NAT

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK241522 (Genbank)

Protein Evidence

Inferred from literature

Literature

PMID: 20081045

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

April 13, 2010

Full-length cDNA

J065170O10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0110050-01)

Others

Oryzabase (10429)

Transcript

1416 bp

>Os01t0110050-01 Pi homeostasis
GTTGGGTAATTAAGCTAAGCTAAGCTAGTTGCTGCGAATGCGATCCTACGTGCATGACAA
TACCTGCTAGCTCATCTCCATCCTCTCTCACCACCAGCTTCCCACTAACCATGGTCACTA
CAGGAGAGAGAGAAAGAGAGAGGTAGCTCAccggcgccggaggtggcggaagaagaagaa
atggaggggtcgtcgccggcggcggcgcgGTGGTGGCCGGAGAGAGACGACGACGACCGC
GACTTGAGGTCGAGGAGTATGTCCATCTGCTTCCGGAGGGAGTGACCTCTGTGGAGGAAC
TCCTCCTCCTTGGCCTTGTAGAAGTGGTTCACCTTGTTCAGCTGCGCGTCCAGCCTCGCG
AAGAACTCCCTCGCCGCCGTCGCCGCCGTCGTCTCCATCTCCGGCGTCACCTCCGTCTCC
ATGATCAGCATTATTGGAGCCAAAGAAGGCCGCCGGGAGCTTGTGCAACAGGAGCCTGCA
GTGAGACAAATTATAACTTGATGGCGCCGCAACTGATTGCTGCTGCTGATGATGATCATG
AGGTGTTGAGGTGGTAATTATGGTCCCTTGGGGAGAATAATCATGCTGCATCCTCTTAAG
ATCTTTCTTGAGCAAGCTATAGTCCACAAAGGCATGCTTCCACTCAGGGACAAGCTGCCC
TTCAAATTGCTTCGAGAACTTCACCATGGGGGAGCCATGGAGGTTGTTATATAGCAGCTA
GCTGATCTGATGGGATGGAATGGAATAATAATCTCTCTCTCTCTCTATCTTTGCAGGTGT
TGCGAGACAACGCATTATATTCTCAGATATACTACACTACGCGTACGTGTTATATCTAGG
CCAGCTAGGCTATATATCTAGCTTAGCTTAAAGCTTGTTGGTGATGGTTGTGCTGGATTG
GATTCCAGGAGAGAAGAGAGACAGAATCAAGAGAAATAGTACTCCATATAGATCAAGGTG
AAGAGAAGAGTGCTCCAGAGAGGACAGAGAGAAATCTAGAGAGAAGCTAGCTAGAGGGAT
GCATATGGAGAGGAAGAAGAGAAACTAGTGCATATATACATATATGCAAGATGAAAGCAT
ATGCATCTGAATGTGAGGATAGTGATCAAGTGGAGACGGATGAGATTAGCAGCTAGTGGG
TGGGTCCCCTCCATATATATATGCATGCCCACATAATTAAGCATGGTGCTCGATCAGTAA
ATCAGTTGGTCCAGATCGACGCCATTATTTGGGAATGCATAGGTGTAGAGCATGCATCCA
CTATTCTCCATATGTCAACAAGCACGATGACATGCATGCATGAAAAAGTGTGCGTATATC
TAATGATATGATCGGGTTTCTACTTTTCCATTATTTTTTTCCAATATGTCTCACTGTAAA
TATAGGAACGTCAATTCAAATATACTTAACTTTCTT

CDS

411 bp

>Os01t0110050-01 Pi homeostasis
CTCAccggcgccggaggtggcggaagaagaagaaatggaggggtcgtcgccggcggcggc
gcgGTGGTGGCCGGAGAGAGACGACGACGACCGCGACTTGAGGTCGAGGAGTATGTCCAT
CTGCTTCCGGAGGGAGTGACCTCTGTGGAGGAACTCCTCCTCCTTGGCCTTGTAGAAGTG
GTTCACCTTGTTCAGCTGCGCGTCCAGCCTCGCGAAGAACTCCCTCGCCGCCGTCGCCGC
CGTCGTCTCCATCTCCGGCGTCACCTCCGTCTCCATGATCAGCATTATTGGAGCCAAAGA
AGGCCGCCGGGAGCTTGTGCAACAGGAGCCTGCAGTGAGACAAATTATAACTTGATGGCG
CCGCAACTGATTGCTGCTGCTGATGATGATCATGAGGTGTTGAGGTGGTAA

Protein

136 aa

>Os01t0110050-01 Pi homeostasis
LTGAGGGGRRRNGGVVAGGGAVVAGERRRRPRLEVEEYVHLLPEGVTSVEELLLLGLVEV
VHLVQLRVQPREELPRRRRRRRLHLRRHLRLHDQHYWSQRRPPGACATGACSETNYNLMA
PQLIAAADDDHEVLRW*

5'UTR

chr01:538499..538644 (- strand) : 146 bp

CDS

chr01:538226..538498 (- strand) : 273 bp

chr01:537917..538054 (- strand) : 138 bp

3'UTR

chr01:537786..537916 (- strand) : 131 bp

chr01:536973..537700 (- strand) : 728 bp

FASTA

>Os01t0110050-01 class=Sequence position=chr01:536973..538644 (- strand)
GTTGGGTAAT TAAGCTAAGC TAAGCTAGTT GCTGCGAATG CGATCCTACG TGCATGACAA TACCTGCTAG CTCATCTCCA
TCCTCTCTCA CCACCAGCTT CCCACTAACC ATGGTCACTA CAGGAGAGAG AGAAAGAGAG AGGTAGCTCA ccggcgccgg
aggtggcgga agaagaagaa atggaggggt cgtcgccggc ggcggcgcgG TGGTGGCCGG AGAGAGACGA CGACGACCGC
GACTTGAGGT CGAGGAGTAT GTCCATCTGC TTCCGGAGGG AGTGACCTCT GTGGAGGAAC TCCTCCTCCT TGGCCTTGTA
GAAGTGGTTC ACCTTGTTCA GCTGCGCGTC CAGCCTCGCG AAGAACTCCC TCGCCGCCGT CGCCGCCGTC GTCTCCATCT
CCGGCGTCAC CTCCGTCTCG TAAACCTCCC CCCTGCCCAC TCTCCGGCGC ACCTATTTTC CATTTATATA TATATGTGCA
CACACAGTAC ATGCAAAAGA TTCAGTACAC ATGCATGGCT ATGGCTTAAT TGCAAAACTG ATAAAAATGG TAGCACAAGG
ATTTACTGTC AATTACTTGT ATGGCTCCAG CATGATCAGC ATTATTGGAG CCAAAGAAGG CCGCCGGGAG CTTGTGCAAC
AGGAGCCTGC AGTGAGACAA ATTATAACTT GATGGCGCCG CAACTGATTG CTGCTGCTGA TGATGATCAT GAGGTGTTGA
GGTGGTAATT ATGGTCCCTT GGGGAGAATA ATCATGCTGC ATCCTCTTAA GATCTTTCTT GAGCAAGCTA TAGTCCACAA
AGGCATGCTT CCACTCAGGG ACAAGCTGCC CTTCAAATTG CTTCGAGAAC TTCACCATGG TTAATTCTAT ATGATCAACT
TAATTAACGA GCAATACGCA TGCAGCTGCT AATTAATTAT ATTGTTGTGT GCTGTGCTGT GCAGGGGGAG CCATGGAGGT
TGTTATATAG CAGCTAGCTG ATCTGATGGG ATGGAATGGA ATAATAATCT CTCTCTCTCT CTATCTTTGC AGGTGTTGCG
AGACAACGCA TTATATTCTC AGATATACTA CACTACGCGT ACGTGTTATA TCTAGGCCAG CTAGGCTATA TATCTAGCTT
AGCTTAAAGC TTGTTGGTGA TGGTTGTGCT GGATTGGATT CCAGGAGAGA AGAGAGACAG AATCAAGAGA AATAGTACTC
CATATAGATC AAGGTGAAGA GAAGAGTGCT CCAGAGAGGA CAGAGAGAAA TCTAGAGAGA AGCTAGCTAG AGGGATGCAT
ATGGAGAGGA AGAAGAGAAA CTAGTGCATA TATACATATA TGCAAGATGA AAGCATATGC ATCTGAATGT GAGGATAGTG
ATCAAGTGGA GACGGATGAG ATTAGCAGCT AGTGGGTGGG TCCCCTCCAT ATATATATGC ATGCCCACAT AATTAAGCAT
GGTGCTCGAT CAGTAAATCA GTTGGTCCAG ATCGACGCCA TTATTTGGGA ATGCATAGGT GTAGAGCATG CATCCACTAT
TCTCCATATG TCAACAAGCA CGATGACATG CATGCATGAA AAAGTGTGCG TATATCTAAT GATATGATCG GGTTTCTACT
TTTCCATTAT TTTTTTCCAA TATGTCTCAC TGTAAATATA GGAACGTCAA TTCAAATATA CTTAACTTTC TT

Locus: Os01g0110050

Loading...

Locus: Os01g0110050

Loading...