Os01t0111100-01

Locus

Os01g0111100

Description

Cyclophilin-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP26-2

CGSNL Gene Name

CYCLOPHILIN 26-2

Oryzabase Gene Symbol Synonym(s)

OsCYP26-2, OsCYP-1, OsCYP26-1

Oryzabase Gene Name Synonym(s)

cyclophilin 26-2, cyclophilin 1

Transcript Evidence

AK065672 (DDBJ, Best hit)

Protein Evidence

NP_565079.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

J013039E22 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0111100-01)

RiceXPro (AK065672)

Others

Oryzabase (10066)

KEGG (Os01t0111100-01 (EC:5.2.1.8))

Transcript

1119 bp

>Os01t0111100-01 Cyclophilin-like domain containing protein.
TCGCCAGCAATGTCGCACCAGATTCTCCACACCTCCAACCCCACGCTGCCGACGCCACCT
CAGCCGCACAACCACCACCCGCCGGTGCCGCCACCGCCCAAGCTCGGTCGCCGCGCTGCG
CTCGCCATCGCGGCCGCTCCGGCCATCCTCAGCGCCACACCCGCACCATCCAGAGCGCAG
GAAGCAGCAGCCGCCGCCGCGGCGCCCTGCATCGCCGACCTGCCCGTCACCGCCAAGGCC
TTCCTGGACGTGTCCATCGGCGGCGAGCCGGCGGGCCGCATCACCATCGGCCTCTTCGGC
GACGCGGCCCCCGCCGGCGCGTCGCGCTTCCTGTCGCTCGTCACGGGCGTCGGCTACCGG
CGCAAGGAGTTCGTCAAGATCGTGCCGGGCTACGTGCAGCACGGCGGCGTGGTGTCGTAC
CCGGCCATCCCGGCGGTGACCGAGCGGCTGGCGGCGGAGATGGGCGCCGTGCGGGCGCAA
TGCGGCGGGGAGAGGAGCCCGCACGCGGCGGCGGGGGCGGTGTCGATCGTGGTGAGGGAC
CCGAGCCTGCCGCCGCCCAAGCCCAAGCTGGTGGCGCGCGGCGGGAAGCTGGAGGTCGAC
CAGGAGCAGGTGGGCGTGGTGCCCAACGGCACCGAGTTCGTCATCACCACCGGCGACGCG
CCGGAGCTGGACGCGTCGGCGCTGGTGGTCGGGAGGGTCGTGGACGGCATGGACGTCCTC
GGCAAGATCGCAGCCGTGCCCACCGTCAAGGATAACACTGCCTCTCCATACTTCAGAGTA
GCCAAGTTGATCGGGGACAAGAGAGCAGTGGTTGCAGAGCGAGGGTTCAACCGCCCATAC
ACCAAGATCCTAATCACCAATTGTGGAGTCATTGAACAGCAGCAGGAGCAGTAGAGTGCT
TTGTTTCTGCCTTGCCTTTCATGTCTCTAGTTTGTGCAAAGGGTAATTATTATTGGAACT
CTGTTTGCAAGAGGATTTTGATTACTCATGGACTGATATAGGCGATGGAGAGGATTAAAA
AGGATTGTGAAGAGATGAGAGTCTTTGTAAAACGCATGTCACACTGTGCTTACAGAACAC
CAACTTATGTTATTAAAAAGAGATGGAGGATATATTGAC

CDS

885 bp

>Os01t0111100-01 Cyclophilin-like domain containing protein.
ATGTCGCACCAGATTCTCCACACCTCCAACCCCACGCTGCCGACGCCACCTCAGCCGCAC
AACCACCACCCGCCGGTGCCGCCACCGCCCAAGCTCGGTCGCCGCGCTGCGCTCGCCATC
GCGGCCGCTCCGGCCATCCTCAGCGCCACACCCGCACCATCCAGAGCGCAGGAAGCAGCA
GCCGCCGCCGCGGCGCCCTGCATCGCCGACCTGCCCGTCACCGCCAAGGCCTTCCTGGAC
GTGTCCATCGGCGGCGAGCCGGCGGGCCGCATCACCATCGGCCTCTTCGGCGACGCGGCC
CCCGCCGGCGCGTCGCGCTTCCTGTCGCTCGTCACGGGCGTCGGCTACCGGCGCAAGGAG
TTCGTCAAGATCGTGCCGGGCTACGTGCAGCACGGCGGCGTGGTGTCGTACCCGGCCATC
CCGGCGGTGACCGAGCGGCTGGCGGCGGAGATGGGCGCCGTGCGGGCGCAATGCGGCGGG
GAGAGGAGCCCGCACGCGGCGGCGGGGGCGGTGTCGATCGTGGTGAGGGACCCGAGCCTG
CCGCCGCCCAAGCCCAAGCTGGTGGCGCGCGGCGGGAAGCTGGAGGTCGACCAGGAGCAG
GTGGGCGTGGTGCCCAACGGCACCGAGTTCGTCATCACCACCGGCGACGCGCCGGAGCTG
GACGCGTCGGCGCTGGTGGTCGGGAGGGTCGTGGACGGCATGGACGTCCTCGGCAAGATC
GCAGCCGTGCCCACCGTCAAGGATAACACTGCCTCTCCATACTTCAGAGTAGCCAAGTTG
ATCGGGGACAAGAGAGCAGTGGTTGCAGAGCGAGGGTTCAACCGCCCATACACCAAGATC
CTAATCACCAATTGTGGAGTCATTGAACAGCAGCAGGAGCAGTAG

Protein

295 aa

>Os01t0111100-01 Cyclophilin-like domain containing protein.
MSHQILHTSNPTLPTPPQPHNHHPPVPPPPKLGRRAALAIAAAPAILSATPAPSRAQEAA
AAAAAPCIADLPVTAKAFLDVSIGGEPAGRITIGLFGDAAPAGASRFLSLVTGVGYRRKE
FVKIVPGYVQHGGVVSYPAIPAVTERLAAEMGAVRAQCGGERSPHAAAGAVSIVVRDPSL
PPPKPKLVARGGKLEVDQEQVGVVPNGTEFVITTGDAPELDASALVVGRVVDGMDVLGKI
AAVPTVKDNTASPYFRVAKLIGDKRAVVAERGFNRPYTKILITNCGVIEQQQEQ*

5'UTR

chr01:587688..587696 (- strand) : 9 bp

CDS

chr01:586921..587687 (- strand) : 767 bp

chr01:586670..586787 (- strand) : 118 bp

3'UTR

chr01:586445..586669 (- strand) : 225 bp

FASTA

>Os01t0111100-01 class=Sequence position=chr01:586445..587696 (- strand)
TCGCCAGCAA TGTCGCACCA GATTCTCCAC ACCTCCAACC CCACGCTGCC GACGCCACCT CAGCCGCACA ACCACCACCC
GCCGGTGCCG CCACCGCCCA AGCTCGGTCG CCGCGCTGCG CTCGCCATCG CGGCCGCTCC GGCCATCCTC AGCGCCACAC
CCGCACCATC CAGAGCGCAG GAAGCAGCAG CCGCCGCCGC GGCGCCCTGC ATCGCCGACC TGCCCGTCAC CGCCAAGGCC
TTCCTGGACG TGTCCATCGG CGGCGAGCCG GCGGGCCGCA TCACCATCGG CCTCTTCGGC GACGCGGCCC CCGCCGGCGC
GTCGCGCTTC CTGTCGCTCG TCACGGGCGT CGGCTACCGG CGCAAGGAGT TCGTCAAGAT CGTGCCGGGC TACGTGCAGC
ACGGCGGCGT GGTGTCGTAC CCGGCCATCC CGGCGGTGAC CGAGCGGCTG GCGGCGGAGA TGGGCGCCGT GCGGGCGCAA
TGCGGCGGGG AGAGGAGCCC GCACGCGGCG GCGGGGGCGG TGTCGATCGT GGTGAGGGAC CCGAGCCTGC CGCCGCCCAA
GCCCAAGCTG GTGGCGCGCG GCGGGAAGCT GGAGGTCGAC CAGGAGCAGG TGGGCGTGGT GCCCAACGGC ACCGAGTTCG
TCATCACCAC CGGCGACGCG CCGGAGCTGG ACGCGTCGGC GCTGGTGGTC GGGAGGGTCG TGGACGGCAT GGACGTCCTC
GGCAAGATCG CAGCCGTGCC CACCGTCAAG GATAACACTG CCTCTCCATA CTTCAGGTCG ATCACTCTCA CTCCAGCTAG
CTGCTTGAAC TGCATTTTGT TGCATCAATC AAACTGAATA GTACTTGCAT CTCAGCTAAT TAAGTCTGGA TTAGACTGAA
CATGTATTAA TATCACTGTG ATTGTGCAGA GTAGCCAAGT TGATCGGGGA CAAGAGAGCA GTGGTTGCAG AGCGAGGGTT
CAACCGCCCA TACACCAAGA TCCTAATCAC CAATTGTGGA GTCATTGAAC AGCAGCAGGA GCAGTAGAGT GCTTTGTTTC
TGCCTTGCCT TTCATGTCTC TAGTTTGTGC AAAGGGTAAT TATTATTGGA ACTCTGTTTG CAAGAGGATT TTGATTACTC
ATGGACTGAT ATAGGCGATG GAGAGGATTA AAAAGGATTG TGAAGAGATG AGAGTCTTTG TAAAACGCAT GTCACACTGT
GCTTACAGAA CACCAACTTA TGTTATTAAA AAGAGATGGA GGATATATTG AC