Os01t0111500-01

Locus

Os01g0111500

Description

ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development

RAP-DB Gene Symbol Synonym(s)

OsbHLH125, OsRSL1

RAP-DB Gene Name Synonym(s)

basic helix-loop-helix protein 125

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH125, bHLH125, OsRSL1, RSL1

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 125, ROOT HAIR DEFECTIVE-SIX LIKE 1

Transcript Evidence

AK108587

Protein Evidence

Q0JRA9

Literature

PMID: 27494519

PMID: 27716929

Note

Manual Curation

October 4, 2016

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Full-length cDNA

002-146-B03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0111500-01)

RiceXPro (AK108587)

Others

Oryzabase (15403)

KEGG (Os01t0111500-01)

Transcript

1475 bp

>Os01t0111500-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
ATGCATACTGAGATCGATCGATCCATCAGGTTGCTACTACCAAGAACAGAAACCCTAGCT
AGCTAGTTAAACATCATCGATCACCATTAGACTAATTTAGAGCTCTTGCTCGATCTTACG
ATACGCAACGTAGTGATCACACTGCTGTGCTGCATCGTATAGTAGCTAGCTAGCTAAACA
CAGAGCTTAATTAGCTGATTAATTAAGGTAGATGATGGCAGCTCAGGCAAGCAGCAAGCG
CGGCATGCTGCTGCCACGGGAGGCGGTGCTCTACGACGACGAGCCCTCCATGCCGCTGGA
GATCTTGGGCTACCACGGCAATGGCGTCGGCGGCGGTGGCTGCGTTGACGCCGATTACTA
CTACAGCTGGTCGGGGTCCAGCTCCAGCTCCAGCTCGTCGGTGCTCAGCTTTGACCAGGC
GGCGGTCGGCGGCAGCGGCGGCGGCTGCGCCCGGCAGCTGGCTTTCCATCCCGGCGGCGA
CGACGACGACTGCGCCATGTGGATGGACGCCGCCGCCGGCGCCATGGTCGAGAACACGTC
TGTCGTCGCCGGCGGCGGCAACAACTACTGTCATCGCCTGCAGTTCCACGGCGGCGCCGC
CGGTTTCGGACTCGCGAGCCCAGGCTCGTCGGTCGTTGACAACGGCCTCGAAATCCACGA
GAGCAACGTCAGCAAGCCGCCACCGCCGGCAGCCAAGAAGCGCGCATGCCCGAGCGGCGA
GGCGAGAGCAGCGGGGAAGAAGCAGTGCAGGAAAGGGAGCAAGCCAAACAAGGCTGCTTC
TGCTTCTTCTCCTTCTCCTTCTCCTTCTCCTTCTCCTTCTCCTAACAAGGAACAACCTCA
AAGCGCCGCTGCAAAGGTAAGAAGAGAGCGGATCAGTGAGAGGCTCAAAGTTCTTCAGGA
TCTCGTGCCTAATGGCACAAAGGTAGACTTGGTCACCATGCTAGAAAAGGCGATCAACTA
CGTCAAATTCCTCCAGCTGCAAGTGAAGGTTTTGGCTACTGATGAGTTCTGGCCGGCACA
AGGAGGGAAAGCACCAGAGCTCTCTCAAGTCAAGGACGCCTTGGACGCCATCCTATCTTC
TCAGCATCCAAACAAATGATGTTGTGCTGCTGACACAAAATGCATCAAATTTCACAAAGC
TAATATTAAGTTTGATGCATGTAAGATCTTTAGAACAGAGGCAATGTAACAGGGCTTCTG
CTCTGAAAAGATGAGAGAATTGTTCTATTGGACTTTCAGAGTTGGAAATCAGTCGTGCAT
CTTAGATGTTTTTTTTCACTCTTTTTTCCTAGATCAATTCTTTCTTGTTTTGTTGCCAAA
GCCTGAGTAATGTACTTCAGTCATCAGAGTTCTTTCACTTTATAGCAAGGATGTAGTGTA
GGTATCAGTTAGAAAACAAGAATCTGAGCACTGCAAATTCGCTTGCTACTGTAAATTACA
CTGCAAATTCCAATAAATGAATCCTAAATAGATGC

CDS

888 bp

>Os01t0111500-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
ATGATGGCAGCTCAGGCAAGCAGCAAGCGCGGCATGCTGCTGCCACGGGAGGCGGTGCTC
TACGACGACGAGCCCTCCATGCCGCTGGAGATCTTGGGCTACCACGGCAATGGCGTCGGC
GGCGGTGGCTGCGTTGACGCCGATTACTACTACAGCTGGTCGGGGTCCAGCTCCAGCTCC
AGCTCGTCGGTGCTCAGCTTTGACCAGGCGGCGGTCGGCGGCAGCGGCGGCGGCTGCGCC
CGGCAGCTGGCTTTCCATCCCGGCGGCGACGACGACGACTGCGCCATGTGGATGGACGCC
GCCGCCGGCGCCATGGTCGAGAACACGTCTGTCGTCGCCGGCGGCGGCAACAACTACTGT
CATCGCCTGCAGTTCCACGGCGGCGCCGCCGGTTTCGGACTCGCGAGCCCAGGCTCGTCG
GTCGTTGACAACGGCCTCGAAATCCACGAGAGCAACGTCAGCAAGCCGCCACCGCCGGCA
GCCAAGAAGCGCGCATGCCCGAGCGGCGAGGCGAGAGCAGCGGGGAAGAAGCAGTGCAGG
AAAGGGAGCAAGCCAAACAAGGCTGCTTCTGCTTCTTCTCCTTCTCCTTCTCCTTCTCCT
TCTCCTTCTCCTAACAAGGAACAACCTCAAAGCGCCGCTGCAAAGGTAAGAAGAGAGCGG
ATCAGTGAGAGGCTCAAAGTTCTTCAGGATCTCGTGCCTAATGGCACAAAGGTAGACTTG
GTCACCATGCTAGAAAAGGCGATCAACTACGTCAAATTCCTCCAGCTGCAAGTGAAGGTT
TTGGCTACTGATGAGTTCTGGCCGGCACAAGGAGGGAAAGCACCAGAGCTCTCTCAAGTC
AAGGACGCCTTGGACGCCATCCTATCTTCTCAGCATCCAAACAAATGA

Protein

296 aa

>Os01t0111500-01 ROOT HAIR DEFECTIVE-SIX LIKE (RSL) class I basic helix-loop-helix protein, bHLH transcription factor, Regulation of root hair development
MMAAQASSKRGMLLPREAVLYDDEPSMPLEILGYHGNGVGGGGCVDADYYYSWSGSSSSS
SSSVLSFDQAAVGGSGGGCARQLAFHPGGDDDDCAMWMDAAAGAMVENTSVVAGGGNNYC
HRLQFHGGAAGFGLASPGSSVVDNGLEIHESNVSKPPPPAAKKRACPSGEARAAGKKQCR
KGSKPNKAASASSPSPSPSPSPSPNKEQPQSAAAKVRRERISERLKVLQDLVPNGTKVDL
VTMLEKAINYVKFLQLQVKVLATDEFWPAQGGKAPELSQVKDALDAILSSQHPNK*

5'UTR

chr01:605433..605643 (- strand) : 211 bp

CDS

chr01:604932..605432 (- strand) : 501 bp

chr01:604681..604824 (- strand) : 144 bp

chr01:604489..604554 (- strand) : 66 bp

chr01:604302..604367 (- strand) : 66 bp

chr01:604019..604129 (- strand) : 111 bp

3'UTR

chr01:603643..604018 (- strand) : 376 bp

FASTA

>Os01t0111500-01 class=Sequence position=chr01:603643..605643 (- strand)
ATGCATACTG AGATCGATCG ATCCATCAGG TTGCTACTAC CAAGAACAGA AACCCTAGCT AGCTAGTTAA ACATCATCGA
TCACCATTAG ACTAATTTAG AGCTCTTGCT CGATCTTACG ATACGCAACG TAGTGATCAC ACTGCTGTGC TGCATCGTAT
AGTAGCTAGC TAGCTAAACA CAGAGCTTAA TTAGCTGATT AATTAAGGTA GATGATGGCA GCTCAGGCAA GCAGCAAGCG
CGGCATGCTG CTGCCACGGG AGGCGGTGCT CTACGACGAC GAGCCCTCCA TGCCGCTGGA GATCTTGGGC TACCACGGCA
ATGGCGTCGG CGGCGGTGGC TGCGTTGACG CCGATTACTA CTACAGCTGG TCGGGGTCCA GCTCCAGCTC CAGCTCGTCG
GTGCTCAGCT TTGACCAGGC GGCGGTCGGC GGCAGCGGCG GCGGCTGCGC CCGGCAGCTG GCTTTCCATC CCGGCGGCGA
CGACGACGAC TGCGCCATGT GGATGGACGC CGCCGCCGGC GCCATGGTCG AGAACACGTC TGTCGTCGCC GGCGGCGGCA
ACAACTACTG TCATCGCCTG CAGTTCCACG GCGGCGCCGC CGGTTTCGGA CTCGCGAGCC CAGGCTCGTC GGTCGTTGAC
AACGGCCTCG AAATCCACGA GAGCAACGTC AGCAAGCCGC CACCGCCGGC AGCCAAGAAG CGCGCATGCC CGGTATGTCA
CTGAATATTA ATCAGATCAC TGTGTCAAAG ATTAATTTCA CAAATTAAAC CAGTAGTGAA TTTCGAGTGA ACCAACAGTA
TAATTTGTGT GTACCGCAGA GCGGCGAGGC GAGAGCAGCG GGGAAGAAGC AGTGCAGGAA AGGGAGCAAG CCAAACAAGG
CTGCTTCTGC TTCTTCTCCT TCTCCTTCTC CTTCTCCTTC TCCTTCTCCT AACAAGGAAC AACCTCAAAG CGCCGCTGCA
AAGGTACAAT AATTACTTTT CTGACTATGT TTAATTTGTA ATTAACACGG TTGTGTTTTG ATCAAATTAA ACTGGATTAT
TATTCAAGTG AGTAGTATTC AATCTTGTTA TATGTATATG TATGTGTAGG TAAGAAGAGA GCGGATCAGT GAGAGGCTCA
AAGTTCTTCA GGATCTCGTG CCTAATGGCA CAAAGGTGCG ATTAGTTCTC AGTATAATTC TTTTGTTTTA AGTTAATTGC
ATGGCTCCTA GTCTATTATC TCTTGATTTT TTTTTTCTTC ATGAGAATAA CTATATATTC ATGTTCGTGC CCGCAGGTAG
ACTTGGTCAC CATGCTAGAA AAGGCGATCA ACTACGTCAA ATTCCTCCAG CTGCAAGTGA AGGTATATTG CAATACTATG
CATGGATAGA GACCATCCAT AGAATATATA GTAGTAGCTC TTTCAGTTCA GTTCACCGTA ATTGATAGTT CTTCACTTCA
GCTCTTATGT TTCACGCAAG TTTAGTGTCT ATGATTAATT AGCTGACCAT AATGATCTGA TTCTGATGAT GCAGGTTTTG
GCTACTGATG AGTTCTGGCC GGCACAAGGA GGGAAAGCAC CAGAGCTCTC TCAAGTCAAG GACGCCTTGG ACGCCATCCT
ATCTTCTCAG CATCCAAACA AATGATGTTG TGCTGCTGAC ACAAAATGCA TCAAATTTCA CAAAGCTAAT ATTAAGTTTG
ATGCATGTAA GATCTTTAGA ACAGAGGCAA TGTAACAGGG CTTCTGCTCT GAAAAGATGA GAGAATTGTT CTATTGGACT
TTCAGAGTTG GAAATCAGTC GTGCATCTTA GATGTTTTTT TTCACTCTTT TTTCCTAGAT CAATTCTTTC TTGTTTTGTT
GCCAAAGCCT GAGTAATGTA CTTCAGTCAT CAGAGTTCTT TCACTTTATA GCAAGGATGT AGTGTAGGTA TCAGTTAGAA
AACAAGAATC TGAGCACTGC AAATTCGCTT GCTACTGTAA ATTACACTGC AAATTCCAAT AAATGAATCC TAAATAGATG
C

Locus: Os01g0111500

Loading...

Locus: Os01g0111500

Loading...