Os01t0118300-01

Locus

Os01g0118300

Description

Similar to Phosphatidyl serine synthase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SUI1

CGSNL Gene Name

SHORTENED UPPERMOST INTERNODE 1

Oryzabase Gene Symbol Synonym(s)

OsSUI1, OsPSS-1, PSS-1, OsPSS1, PSS1

Oryzabase Gene Name Synonym(s)

Shortened Uppermost Internode 1, Phosphatidylserine Synthase 1

Transcript Evidence

AK065788 (DDBJ, Best hit)

Protein Evidence

E0Y3X2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: phosphatidylserine biosynthetic process (GO:0006659)

Functional domain (InterPro)

Phosphatidyl serine synthase (IPR004277)

Full-length cDNA

J013041H16 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0118300-01)

Others

Oryzabase (11428)

Transcript

2915 bp

>Os01t0118300-01 Similar to Phosphatidyl serine synthase.
ATTCTGCTAAAAATTTCATCTTGGGGGGTATATTTCTCATATTTTAGTTCATGCCGCCGC
CACTATGTACTAATCCCACCATAGCAGCTCATAGTATTCTCCATTGCAATCCTGTCGTCT
ATTTGTATTTGTTTTTTGTTTGTTAGTATTAGGGTGCTTTTGGGTTTGGGGTTTCTGCCA
TTGACGGTTACCTGAAGAGCTCTCGATGAAGCGGTTCTTTTTTATTTTATTTTATTTTCG
GTGCCTAGTGAAATACAGTGGTGGTTTTGAATCATTCCTGGGAGTTCCCTGGTGGTTTTG
ACTGATCAAAACGCTACATTTTTTTTATGTTTATGTTCCCTGTTGTTGTTTCTTGCCCAA
ATGCAGATTCACTCTTGCATTTGTTTCTCTTGATTTCCTCTGCTGTTTTGCTCTACAAGG
ACAGAGGACTTAGTCTGCTTGTTCGTCAGCCTTGCAGGAAAAAAAATGCAGTAAAAAACC
TGTCTATTGCGATTACTTTGTGTTCATCTTGGGGCGCTCTTATTATGCGTGGGAATCACC
AGCAGAGTTCATCCGATTTGATGCGCGCATCTCTAATTCCCATCTTTTGCAGCATTGCAA
AAGCTGCTGCCTTTTAGCTTTTGCGCTTTCTTAATTAGGAGGGGTTGTACGGCGCCCCTG
TTGGACCTGATTACTTCCACAGTAATTGCATCATGACATTTTATTCCTTTTTAATCGTTT
CCTTTTGCTAATCTTTTTAAGTACAAATGGAGTTTCCCCCCAAAAAAATATTGCAAATGG
AGTTTTTTTTTCCCCTTCTCCTCTCGCCTTTTGCTGTTTCAGGTTTCGTATGTTATCTTC
ACATCAATGCAGCCTTTAATTGCAGCAGACCACCCTTCTTTGCTACTAGTATGGGAAAAA
AAAATCAGAGCCACACGAACTGTGGGTATTTGCTATGGGAACTTCACAAGTTCGCCAGCA
ATACAACTTGAATGCGTCCTGAAGATCTAGATTCCGCAGGTCAAATCGTCGAATTTCAGA
GCTAGTAGTACTGTAGGCTTGCCTGGTGCAACTGTGGGTTATGCTTCAATAGCCTTTAAC
TGTGGGTTAATGTGTAGAGTATATGTCAAATACAGAATTTTTACTTGAAGAAGATGTGTT
TATTTTCAGATGTGTTGGACCATTTCATGTTGTCCACTTGTAGGTACTTTCGTGGCCTAA
GTAGTACATTATTCAGTTGTTAGTTATTTGTCTCACTGAATGCAAGTGTATCTTTAGTAA
GAGTTGGACTGCATTGTACTTGTTTTAATCTTCTTGAAGGCCAGTAAGAATTTGTACTCT
AATACAAAATTGTGGAAATTTTACAGATAATAAGCTGCTAAGAATTATCACCATGGAGGT
CAATGGTCATCACAAACCAAGAAGAGAATATAATGGCCGAGAGTGCAATGGTGTACAATC
AGTAAACAATTTTGGCGATATCGATCCATGGACAGCATGGGCATACAAACCGCGCACAGT
TTCATTGCTACTGATGGGAACATGCTTTTTAATTTGGGCAAGTGGTGCTCTTGATCCAGA
AAGAAGCTTCTCTGTTGACCGCGTTTCATCTGTTAAAAGGGGTGTCTTTGCAATGATTGC
TGTTTTTTTGGCTTATTCATTTCTTCAGGCACCTTCTACTGTACTTATTAGACCACATCC
TGCCATTTGGCGGCTGGTCCACGGGATGGCAGTTGTTTACCTTGTTGCTCTAACTTTTTT
GCTTTTCCAGACCCGTGATGATGCTAGGCAATTTATGAAGTATCTTCACCCTGATCTTGG
TGTTGAATTACCTGAAAGATCTTATGGAACCGACTGCCGCATATATGTACCTGATCATCC
GAAAAGCAGGTTTCTCTAGGAGATCCTTTTTGATGAGTTTGTTATTGCCCATATCCTTGG
ATGGTGGGGGAAGGCTATAATGATAAGAAACCAACCACTTTTATGGGTATTATCAATTGG
CTTTGAGCTAATGGAGCTCACCTTTCGCCATATGCTGCCAAACTTTAATGAGTGTTGGTG
GGATAGCATCGTACTAGACATATTAATCTGCAATTGGTTTGGTATTTGGGCTGGAATGAA
GACTGTGAGATACTTTGATGGGAGGACATATGAATGGGTTGGTTTGAGTCGTCAACCCAA
TATTATCAGTAAGGTAAAAAGGACGCTAGGCCAGTTCACACCAGCACAGTGGGACAAAGA
TGAGTGGTACCCTCTGCTTGGCCCTTGGAGATTCATCCAGGTGCTGAGCCTATGTATTGT
TTTCATGATTGTTGAACTTAACACATTCTTTCTCAAGTTCTGCCTTTGGATTCCTCCCCG
AAACCCCTTGATTGTTTACCGACTTGTCCTTTGGTGGTTAATTGCGATACCAACCATTCG
CGAGTACAATACATACTTACAAGACAGGAAACCTGTTAAAAAGGTGGGGTCTTTCTGTTG
GCTTTCCCTAGCTATTTGCATTTTGGAGCTTCTACTATGCATCAAGTTTGGACATGGTCT
CTTTCCGAAGTCGATGCCGTCATGGTTGTTCATAGCCTGGACGACCGTGGCGTCGCTTCT
GATGATGTTCCTTCTTGTGTGGACTTGGAAAATTTACCGAACAATGATAAGGAAAAGGCT
ATGATTCTTCTGTTGCTTTGCTCTCAATTCTTTCCTCCTCCATTCAATATTGTCGTGTAA
ATATTCATTCAAAAAAATCTGTACATGTGGTAGTAGCCATTAATTTGGTGGTCTCGAGAA
GGATCATCATAAGGAATTTTATGTCTTTGCCTTTGTATTCCATGAGCCAAAATGGCATTC
CCTTTTCCTTCCTGTGATGTAACTCTGACAGCCAAACTTTAGTGTTCCTTTGGTCCAATC
TAATTCCTGGGAAATAATGAACCAAGATTTATTCT

CDS

507 bp

>Os01t0118300-01 Similar to Phosphatidyl serine synthase.
ATGGAGGTCAATGGTCATCACAAACCAAGAAGAGAATATAATGGCCGAGAGTGCAATGGT
GTACAATCAGTAAACAATTTTGGCGATATCGATCCATGGACAGCATGGGCATACAAACCG
CGCACAGTTTCATTGCTACTGATGGGAACATGCTTTTTAATTTGGGCAAGTGGTGCTCTT
GATCCAGAAAGAAGCTTCTCTGTTGACCGCGTTTCATCTGTTAAAAGGGGTGTCTTTGCA
ATGATTGCTGTTTTTTTGGCTTATTCATTTCTTCAGGCACCTTCTACTGTACTTATTAGA
CCACATCCTGCCATTTGGCGGCTGGTCCACGGGATGGCAGTTGTTTACCTTGTTGCTCTA
ACTTTTTTGCTTTTCCAGACCCGTGATGATGCTAGGCAATTTATGAAGTATCTTCACCCT
GATCTTGGTGTTGAATTACCTGAAAGATCTTATGGAACCGACTGCCGCATATATGTACCT
GATCATCCGAAAAGCAGGTTTCTCTAG

Protein

169 aa

>Os01t0118300-01 Similar to Phosphatidyl serine synthase.
MEVNGHHKPRREYNGRECNGVQSVNNFGDIDPWTAWAYKPRTVSLLLMGTCFLIWASGAL
DPERSFSVDRVSSVKRGVFAMIAVFLAYSFLQAPSTVLIRPHPAIWRLVHGMAVVYLVAL
TFLLFQTRDDARQFMKYLHPDLGVELPERSYGTDCRIYVPDHPKSRFL*

5'UTR

chr01:1046604..1047975 (+ strand) : 1372 bp

CDS

chr01:1047976..1048136 (+ strand) : 161 bp

chr01:1048358..1048423 (+ strand) : 66 bp

chr01:1048736..1048795 (+ strand) : 60 bp

chr01:1049159..1049249 (+ strand) : 91 bp

chr01:1050163..1050217 (+ strand) : 55 bp

chr01:1050308..1050371 (+ strand) : 64 bp

chr01:1050498..1050507 (+ strand) : 10 bp

3'UTR

chr01:1050508..1050624 (+ strand) : 117 bp

chr01:1050712..1050796 (+ strand) : 85 bp

chr01:1051375..1051466 (+ strand) : 92 bp

chr01:1051947..1052200 (+ strand) : 254 bp

chr01:1052592..1052680 (+ strand) : 89 bp

chr01:1052768..1053166 (+ strand) : 399 bp

FASTA

>Os01t0118300-01 class=Sequence position=chr01:1046604..1053166 (+ strand)
ATTCTGCTAA AAATTTCATC TTGGGGGGTA TATTTCTCAT ATTTTAGTTC ATGCCGCCGC CACTATGTAC TAATCCCACC
ATAGCAGCTC ATAGTATTCT CCATTGCAAT CCTGTCGTCT ATTTGTATTT GTTTTTTGTT TGTTAGTATT AGGGTGCTTT
TGGGTTTGGG GTTTCTGCCA TTGACGGTTA CCTGAAGAGC TCTCGATGAA GCGGTTCTTT TTTATTTTAT TTTATTTTCG
GTGCCTAGTG AAATACAGTG GTGGTTTTGA ATCATTCCTG GGAGTTCCCT GGTGGTTTTG ACTGATCAAA ACGCTACATT
TTTTTTATGT TTATGTTCCC TGTTGTTGTT TCTTGCCCAA ATGCAGATTC ACTCTTGCAT TTGTTTCTCT TGATTTCCTC
TGCTGTTTTG CTCTACAAGG ACAGAGGACT TAGTCTGCTT GTTCGTCAGC CTTGCAGGAA AAAAAATGCA GTAAAAAACC
TGTCTATTGC GATTACTTTG TGTTCATCTT GGGGCGCTCT TATTATGCGT GGGAATCACC AGCAGAGTTC ATCCGATTTG
ATGCGCGCAT CTCTAATTCC CATCTTTTGC AGCATTGCAA AAGCTGCTGC CTTTTAGCTT TTGCGCTTTC TTAATTAGGA
GGGGTTGTAC GGCGCCCCTG TTGGACCTGA TTACTTCCAC AGTAATTGCA TCATGACATT TTATTCCTTT TTAATCGTTT
CCTTTTGCTA ATCTTTTTAA GTACAAATGG AGTTTCCCCC CAAAAAAATA TTGCAAATGG AGTTTTTTTT TCCCCTTCTC
CTCTCGCCTT TTGCTGTTTC AGGTTTCGTA TGTTATCTTC ACATCAATGC AGCCTTTAAT TGCAGCAGAC CACCCTTCTT
TGCTACTAGT ATGGGAAAAA AAAATCAGAG CCACACGAAC TGTGGGTATT TGCTATGGGA ACTTCACAAG TTCGCCAGCA
ATACAACTTG AATGCGTCCT GAAGATCTAG ATTCCGCAGG TCAAATCGTC GAATTTCAGA GCTAGTAGTA CTGTAGGCTT
GCCTGGTGCA ACTGTGGGTT ATGCTTCAAT AGCCTTTAAC TGTGGGTTAA TGTGTAGAGT ATATGTCAAA TACAGAATTT
TTACTTGAAG AAGATGTGTT TATTTTCAGA TGTGTTGGAC CATTTCATGT TGTCCACTTG TAGGTACTTT CGTGGCCTAA
GTAGTACATT ATTCAGTTGT TAGTTATTTG TCTCACTGAA TGCAAGTGTA TCTTTAGTAA GAGTTGGACT GCATTGTACT
TGTTTTAATC TTCTTGAAGG CCAGTAAGAA TTTGTACTCT AATACAAAAT TGTGGAAATT TTACAGATAA TAAGCTGCTA
AGAATTATCA CCATGGAGGT CAATGGTCAT CACAAACCAA GAAGAGAATA TAATGGCCGA GAGTGCAATG GTGTACAATC
AGTAAACAAT TTTGGCGATA TCGATCCATG GACAGCATGG GCATACAAAC CGCGCACAGT TTCATTGCTA CTGATGGGAA
CATGCTTTTT AATGTGAGAT CAGAATCTTT ATCTGTGGAT TTTTTTTAAA GATTTTAAAG AGCATTTTAA TAATCAAGGT
GTTTTATGCA TTTGTTAGTG TTGGCCTACG GCACCTTTTT GAAATATGTT TTATTTTCTT CAGTTTCGAC CATTGTTAGG
ACTATCAACA AGATATTTAG GACTTGCAAA GGTGCTCTAT GTTTAACAGA AATTTAATTT ACATTCTTTA TCAGTTGGGC
AAGTGGTGCT CTTGATCCAG AAAGAAGCTT CTCTGTTGAC CGCGTTTCAT CTGTTAAAAG GTATTCTACT CATCCAGGTT
AGACGGTAGT TGTTTTTACC ATTCACTCAC TAATTGGACA TCTTTAAAAC TAGTGTTACC TGGTCATCTG TGTTCAAAAT
ATTTTTTATT GAAATCACAC GAGTCAGATC CATAGCAGAT TTCATGTGTT GATGTTTTTT TTGCTGCACT AGACACGCAA
ATTCTAGTCG GTTTCCAACC ACATGAGTGT TCATTTTATT TTTACCATCA TTTTTCTCAA CAATTTATCT GTTGATTATC
ATTTAAGGAT TCCTTTTTGT TGATATGTCA TATGTTTCTC TTTTATTGAC AGGGGTGTCT TTGCAATGAT TGCTGTTTTT
TTGGCTTATT CATTTCTTCA GGCACCTTCT ACGTGAGTCA CATAAACCCC TTATCCGAAC TCTGATTATC GAACTCTGTT
TATGGTAGGG ATGGCCGTGC AGATATAAAT AATGCTATTG CACATTGATA TGGAACAGAA GGGGGTACGC GTTCCTGCGT
ACTCCATTTC TGAAAATAAC TTTTCAATAT CACTGAGGAA TTGTATCATT TTCCTAGATG TGTTACTTTT ATCATGAAAC
TGAAATAACT TCATAAATTC TCCTAAATAA CAGTTTTAAT TTAAAAATCC CTTGAAAGTG AGGCACTGTT CCATTTCCTA
AAAATATAAC CTCATTGGGG GCTTCTCTGT AATTTTGTTT AACATTTACT TATATTTATT TATACTATGA TTCAGTGTAC
TTATTAGACC ACATCCTGCC ATTTGGCGGC TGGTCCACGG GATGGCAGTT GTTTACCTTG TTGCTCTAAC TTTTTTGCTT
TTCCAGGTAA GTACAGCTTT TTCTTATTAC TCTTGCTCAA CACATTTTTA TTGGATCATT GATATTCATG GATTATTAAG
GCATTGCATT CTTTTACTTT TTTTATCTCT TCCACATAAC CTTATAATAT CAACTTCTTT TCTAATGAAC GGCATAGAAG
TCCCTGTCTC AGTTTCTCGT TTAATTGATT AGCATAAGGA ATTGCACTGT GCACTAATAC CTCACTTCCC TCTTGATTCC
AACCAAAAAT AGGTTATTTT TATTAAAGGA AAAAAGAGTC GTCATTGGCA TTACACATCA GCAGCAGAAG ATGAGGTTAC
CAATGTCAAA AGTTTAACAG TATAACTATA GGTGAACATA GATCAGTTTG GAACTAGGAT GACTCAAGAG ATTAACACAC
ATTGGAAAGA AAAGCCTGGT ATCCCATTTT TATGTTACCC TGGGAACTTT TTTAGTCAAt aggaagcttc ccagaaatgt
tttcaagtca tccaactaat tgcgattagt catcctagtc ggtactaagg caacttgatt ctaaccacga ttgatcggaa
agtctcctaa ttagtcgcga ttagttatga ttaatcatcc TAGTCGGTAC TGAGGTGATT TTCCTCGAGT TTCCGATTTG
AAAACATGCT GCCTTGTTGT GGTTTACTCC TAGAGGTAGC TAGTCAAAGT GCCAAGAGAC TATTCTCCCG TATCTTTACT
ATTGTGCTAT ACTGGTCCAT GTTGCATGCA CCAGATGAGA CAATGTCTCA AAAAGTGAGG GTCTTGTTAT AAATATTTTT
TTTCTTCTCA AATACGCAAG AGAATTGTGC ATCATTGGTC TTGTTATAAA TATCATAAAA GAGAGAACAA AACCTGTAGT
TTGCATGGGA TTCATACTCT GTTCCACTTA ATCTTGCAGA CCCGTGATGA TGCTAGGCAA TTTATGAAGT ATCTTCACCC
TGATCTTGGT GTTGGTAATG AATTTAATTT CCATATATGA TCTAGCAGTG CAGAGTTATG TGATTGGAAA AATAAAAACC
TGATTTTTAC CCACCTTTGA GCAGAATTAC CTGAAAGATC TTATGGAACC GACTGCCGCA TATATGTACC TGATCATCCG
AAAAGCAGGT TTAACAATGT TTATGTATGA CTCCATTCAC CAACTTGCTT CTCCTTTTTG TTCTATTTGA TTTACCTTAA
AACTCCAGTT CTGCAAAGTC TTGGAGATGC TTCAAGTTAC TGATTTGAAT ATAGGTTTCT CTAGGAGATC CTTTTTGATG
AGTTTGTTAT TGCCCATATC CTTGGATGGT GGGGGAAGGC TATAATGATA AGAAACCAAC CACTTTTATG GGTATTATCA
ATTGGCTTTG AGCTAATGGA GGTATGCATT TAATCTTACA CGATCAATTT ATTTTTGGCT TCTGTCTTCT GAATCTAGAT
TCCTTACATA GTTTCACATG TCCTGCAGCT CACCTTTCGC CATATGCTGC CAAACTTTAA TGAGTGTTGG TGGGATAGCA
TCGTACTAGA CATATTAATC TGCAATTGGT TTGGTGAGAT TTTTTATATT TTATCAGTAT TTTTAATATA CAATTCTCAT
TTCCTTTAAA TGTAGATTAG ACACCCTCAT TCAGTTTATT CAGAAATCAT TTTTTTGTTT ATTGGCTTCT TTCTTTATTG
TGGTTGTATA AGCTGCTGGA GTAGTATCTT CTGATTTACT GAAACCTCAT TCAGAATTTT GTACCTTAGC ATATTAAAGT
TAATCATGGC AAACCTATGT TTCACATTGT TTTGCTTATC TCTTTCTGCA AATCGCTAAG ACAGAATATT AGTGTTTTAA
TAGTTTTGTG ATGTATTAGA CATCTTTTAA ATGCTAAGTG TACCTATGGT ATTTCACTAG CTATTTCGTA TGAAGTTGTG
CGCTATAATT GTTACTTTAA ATGCTAAGAT ATTTCATGTG ATTAAAATTT CGGGACAGTT TTCATGCGAA TGTCTGTCTT
TACCTCTATT CGTTAGCCTC CCATAAGTTT GATTCTTCTC TGCTGCAACA TCGTGTTATG TATCTTTTGC TTGAGTAATA
GAGTGACAGT TGCTTTCAAC TCTTCCTGAC TGGGACCCTT ATTTGGTTTA GGTATTTGGG CTGGAATGAA GACTGTGAGA
TACTTTGATG GGAGGACATA TGAATGGGTT GGTTTGAGTC GTCAACCCAA TATTATCAGT AAGGTATGCT CATTAGATGT
CAAGGGGAAT GAAGTTGCCC AGCAAAGCAT ATGGTGGCAT TATACTTTTC TTTTTTTTGG CATCTGTCCC ATTTTTATGC
AGTGCATTGT GTTGTATATC TTGCCTTAGT ATCATATTAA GGTGATTAAC TCTAATACAG GTAGGATTTA CTGAGAAACC
AACACAATTT GTCATTAGTT GTCTAATTAG CCCAATATGC ACCATACTGT TAGGTACCTG TAAATACATG TATAAAATGA
AAATATTATG TGTGTGACGT TTATATCTTG ACTTTCAAAT CCGGTTTTTT CTATGCATAG GTTAATACCG TACTACGGTA
TAGTATTAAA CTCAACCATT AATTTTTCCC TTGAATGTTA TATGCTATGT TCTGTATTTC TAGTGCTTCG AATTATTTGT
TCTTGATCTT TATATTGTTA GCCTTTCCCG TGAGTGCATA TTTCACCTTT TGCTTCTCCA TAGGTAAAAA GGACGCTAGG
CCAGTTCACA CCAGCACAGT GGGACAAAGA TGAGTGGTAC CCTCTGCTTG GCCCTTGGAG ATTCATCCAG GTGCTGAGCC
TATGTATTGT TTTCATGATT GTTGAACTTA ACACATTCTT TCTCAAGTTC TGCCTTTGGA TTCCTCCCCG AAACCCCTTG
ATTGTTTACC GACTTGTCCT TTGGTGGTTA ATTGCGATAC CAACCATTCG CGAGTACAAT ACATACTTAC AAGACAGGTG
AATATTGAAC TCCCTAAGCT TCTTTTTTTG AATGTATGAA CTTAATTAGC TTCAAACTGT AAAAAAAAAT AAATCTCTAA
GTATGTTTTG ATGAGTTGCT CTGTACTCAT CCAGCATTAT CGACTGTTCA AGAACAGAAA CTCTGGATTT TCTTGGATGC
ACTGTGCCTG CTATTAACTA TTACTGCTTG ACATGCTACA TGGCAGTGCA GATGTGCCAC TATTTGTTGA CCATAAATAT
GTACCGTCTG CTAGACATTG GTTGCATGTG AACTGTGTGT AGTATAGACA GCATTCTAAC TGCATGCTTA CAATAGGATC
AAACAGCTTG GCTATAAGTT CACAGAATTC ATACCCATTA ATAATATAAC TTGTCTGAAT GATTGCAGGA AACCTGTTAA
AAAGGTGGGG TCTTTCTGTT GGCTTTCCCT AGCTATTTGC ATTTTGGAGC TTCTACTATG CATCAAGTTT GGACATGGTG
AGTTTGATGT AAATTTCTTG ATGCTTGCAA GCAACATTTG CATCCTTAAA ATTAACCGTT CTGAACACGT TGGCTTGTGA
ACAGGTCTCT TTCCGAAGTC GATGCCGTCA TGGTTGTTCA TAGCCTGGAC GACCGTGGCG TCGCTTCTGA TGATGTTCCT
TCTTGTGTGG ACTTGGAAAA TTTACCGAAC AATGATAAGG AAAAGGCTAT GATTCTTCTG TTGCTTTGCT CTCAATTCTT
TCCTCCTCCA TTCAATATTG TCGTGTAAAT ATTCATTCAA AAAAATCTGT ACATGTGGTA GTAGCCATTA ATTTGGTGGT
CTCGAGAAGG ATCATCATAA GGAATTTTAT GTCTTTGCCT TTGTATTCCA TGAGCCAAAA TGGCATTCCC TTTTCCTTCC
TGTGATGTAA CTCTGACAGC CAAACTTTAG TGTTCCTTTG GTCCAATCTA ATTCCTGGGA AATAATGAAC CAAGATTTAT
TCT