Os01t0118300-02

Locus

Os01g0118300

Description

Phosphatidylserine synthase, Regulation of stem development, Control of cell elongation in uppermost internode

RAP-DB Gene Symbol Synonym(s)

SUI1, OsSUI1, OsPSS-1, PSS-1, OsPSS1, PSS1

RAP-DB Gene Name Synonym(s)

SHORTENED UPPERMOST INTERNODE 1, Shortened Uppermost Internode 1, Phosphatidylserine Synthase 1

CGSNL Gene Symbol

SUI1

CGSNL Gene Name

SHORTENED UPPERMOST INTERNODE 1

Oryzabase Gene Symbol Synonym(s)

OsSUI1, OsPSS-1, PSS-1, OsPSS1, PSS1

Oryzabase Gene Name Synonym(s)

Shortened Uppermost Internode 1, Phosphatidylserine Synthase 1

Transcript Evidence

GU564663

Protein Evidence

Q0JR55

Literature

PMID: 27055010

PMID: 22956125

PMID: 21928114

Note

Manual Curation

February 24, 2017

Gene Ontology (GO)

Biological Process: phosphatidylserine biosynthetic process (GO:0006659)

Functional domain (InterPro)

Phosphatidyl serine synthase (IPR004277)

Others

Oryzabase (11428)

Transcript

1624 bp

>Os01t0118300-02 Phosphatidylserine synthase, Regulation of stem development, Control of cell elongation in uppermost internode
AGGCCAGTAAGAATTTGTACTCTAATACAAAATTGTGGAAATTTTACAGATAATAAGCTG
CTAAGAATTATCACCATGGAGGTCAATGGTCATCACAAACCAAGAAGAGAATATAATGGC
CGAGAGTGCAATGGTGTACAATCAGTAAACAATTTTGGCGATATCGATCCATGGACAGCA
TGGGCATACAAACCGCGCACAGTTTCATTGCTACTGATGGGAACATGCTTTTTAATTTGG
GCAAGTGGTGCTCTTGATCCAGAAAGAAGCTTCTCTGTTGACCGCGTTTCATCTGTTAAA
AGGGGTGTCTTTGCAATGATTGCTGTTTTTTTGGCTTATTCATTTCTTCAGGCACCTTCT
ACTGTACTTATTAGACCACATCCTGCCATTTGGCGGCTGGTCCACGGGATGGCAGTTGTT
TACCTTGTTGCTCTAACTTTTTTGCTTTTCCAGACCCGTGATGATGCTAGGCAATTTATG
AAGTATCTTCACCCTGATCTTGGTGTTGAATTACCTGAAAGATCTTATGGAACCGACTGC
CGCATATATGTACCTGATCATCCGAAAAGCAGGTTTAACAATGTTTATGAGATCCTTTTT
GATGAGTTTGTTATTGCCCATATCCTTGGATGGTGGGGGAAGGCTATAATGATAAGAAAC
CAACCACTTTTATGGGTATTATCAATTGGCTTTGAGCTAATGGAGCTCACCTTTCGCCAT
ATGCTGCCAAACTTTAATGAGTGTTGGTGGGATAGCATCGTACTAGACATATTAATCTGC
AATTGGTTTGGTATTTGGGCTGGAATGAAGACTGTGAGATACTTTGATGGGAGGACATAT
GAATGGGTTGGTTTGAGTCGTCAACCCAATATTATCAGTAAGGTAAAAAGGACGCTAGGC
CAGTTCACACCAGCACAGTGGGACAAAGATGAGTGGTACCCTCTGCTTGGCCCTTGGAGA
TTCATCCAGGTGCTGAGCCTATGTATTGTTTTCATGATTGTTGAACTTAACACATTCTTT
CTCAAGTTCTGCCTTTGGATTCCTCCCCGAAACCCCTTGATTGTTTACCGACTTGTCCTT
TGGTGGTTAATTGCGATACCAACCATTCGCGAGTACAATACATACTTACAAGACAGGAAA
CCTGTTAAAAAGGTGGGGTCTTTCTGTTGGCTTTCCCTAGCTATTTGCATTTTGGAGCTT
CTACTATGCATCAAGTTTGGACATGGTCTCTTTCCGAAGTCGATGCCGTCATGGTTGTTC
ATAGCCTGGACGACCGTGGCGTCGCTTCTGATGATGTTCCTTCTTGTGTGGACTTGGAAA
ATTTACCGAACAATGATAAGGAAAAGGCTATGATTCTTCTGTTGCTTTGCTCTCAATTCT
TTCCTCCTCCATTCAATATTGTCGTGTAAATATTCATTCAAAAAAATCTGTACATGTGGT
AGTAGCCATTAATTTGGTGGTCTCGAGAAGGATCATCATAAGGAATTTTATGTCTTTGCC
TTTGTATTCCATGAGCCAAAATGGCATTCCCTTTTCCTTCCTGTGATGTAACTCTGACAG
CCAAACTTTAGTGTTCCTTTGGTCCAATCTAATTCCTGGGAAATAATGAACCAAGATTTA
TTCT

CDS

1278 bp

>Os01t0118300-02 Phosphatidylserine synthase, Regulation of stem development, Control of cell elongation in uppermost internode
ATGGAGGTCAATGGTCATCACAAACCAAGAAGAGAATATAATGGCCGAGAGTGCAATGGT
GTACAATCAGTAAACAATTTTGGCGATATCGATCCATGGACAGCATGGGCATACAAACCG
CGCACAGTTTCATTGCTACTGATGGGAACATGCTTTTTAATTTGGGCAAGTGGTGCTCTT
GATCCAGAAAGAAGCTTCTCTGTTGACCGCGTTTCATCTGTTAAAAGGGGTGTCTTTGCA
ATGATTGCTGTTTTTTTGGCTTATTCATTTCTTCAGGCACCTTCTACTGTACTTATTAGA
CCACATCCTGCCATTTGGCGGCTGGTCCACGGGATGGCAGTTGTTTACCTTGTTGCTCTA
ACTTTTTTGCTTTTCCAGACCCGTGATGATGCTAGGCAATTTATGAAGTATCTTCACCCT
GATCTTGGTGTTGAATTACCTGAAAGATCTTATGGAACCGACTGCCGCATATATGTACCT
GATCATCCGAAAAGCAGGTTTAACAATGTTTATGAGATCCTTTTTGATGAGTTTGTTATT
GCCCATATCCTTGGATGGTGGGGGAAGGCTATAATGATAAGAAACCAACCACTTTTATGG
GTATTATCAATTGGCTTTGAGCTAATGGAGCTCACCTTTCGCCATATGCTGCCAAACTTT
AATGAGTGTTGGTGGGATAGCATCGTACTAGACATATTAATCTGCAATTGGTTTGGTATT
TGGGCTGGAATGAAGACTGTGAGATACTTTGATGGGAGGACATATGAATGGGTTGGTTTG
AGTCGTCAACCCAATATTATCAGTAAGGTAAAAAGGACGCTAGGCCAGTTCACACCAGCA
CAGTGGGACAAAGATGAGTGGTACCCTCTGCTTGGCCCTTGGAGATTCATCCAGGTGCTG
AGCCTATGTATTGTTTTCATGATTGTTGAACTTAACACATTCTTTCTCAAGTTCTGCCTT
TGGATTCCTCCCCGAAACCCCTTGATTGTTTACCGACTTGTCCTTTGGTGGTTAATTGCG
ATACCAACCATTCGCGAGTACAATACATACTTACAAGACAGGAAACCTGTTAAAAAGGTG
GGGTCTTTCTGTTGGCTTTCCCTAGCTATTTGCATTTTGGAGCTTCTACTATGCATCAAG
TTTGGACATGGTCTCTTTCCGAAGTCGATGCCGTCATGGTTGTTCATAGCCTGGACGACC
GTGGCGTCGCTTCTGATGATGTTCCTTCTTGTGTGGACTTGGAAAATTTACCGAACAATG
ATAAGGAAAAGGCTATGA

Protein

426 aa

>Os01t0118300-02 Phosphatidylserine synthase, Regulation of stem development, Control of cell elongation in uppermost internode
MEVNGHHKPRREYNGRECNGVQSVNNFGDIDPWTAWAYKPRTVSLLLMGTCFLIWASGAL
DPERSFSVDRVSSVKRGVFAMIAVFLAYSFLQAPSTVLIRPHPAIWRLVHGMAVVYLVAL
TFLLFQTRDDARQFMKYLHPDLGVELPERSYGTDCRIYVPDHPKSRFNNVYEILFDEFVI
AHILGWWGKAIMIRNQPLLWVLSIGFELMELTFRHMLPNFNECWWDSIVLDILICNWFGI
WAGMKTVRYFDGRTYEWVGLSRQPNIISKVKRTLGQFTPAQWDKDEWYPLLGPWRFIQVL
SLCIVFMIVELNTFFLKFCLWIPPRNPLIVYRLVLWWLIAIPTIREYNTYLQDRKPVKKV
GSFCWLSLAICILELLLCIKFGHGLFPKSMPSWLFIAWTTVASLLMMFLLVWTWKIYRTM
IRKRL*

5'UTR

chr01:1047901..1047975 (+ strand) : 75 bp

CDS

chr01:1047976..1048136 (+ strand) : 161 bp

chr01:1048358..1048423 (+ strand) : 66 bp

chr01:1048736..1048795 (+ strand) : 60 bp

chr01:1049159..1049249 (+ strand) : 91 bp

chr01:1050163..1050217 (+ strand) : 55 bp

chr01:1050308..1050387 (+ strand) : 80 bp

chr01:1050508..1050624 (+ strand) : 117 bp

chr01:1050712..1050796 (+ strand) : 85 bp

chr01:1051375..1051466 (+ strand) : 92 bp

chr01:1051947..1052200 (+ strand) : 254 bp

chr01:1052592..1052680 (+ strand) : 89 bp

chr01:1052768..1052895 (+ strand) : 128 bp

3'UTR

chr01:1052896..1053166 (+ strand) : 271 bp

FASTA

>Os01t0118300-02 class=Sequence position=chr01:1047901..1053166 (+ strand)
AGGCCAGTAA GAATTTGTAC TCTAATACAA AATTGTGGAA ATTTTACAGA TAATAAGCTG CTAAGAATTA TCACCATGGA
GGTCAATGGT CATCACAAAC CAAGAAGAGA ATATAATGGC CGAGAGTGCA ATGGTGTACA ATCAGTAAAC AATTTTGGCG
ATATCGATCC ATGGACAGCA TGGGCATACA AACCGCGCAC AGTTTCATTG CTACTGATGG GAACATGCTT TTTAATGTGA
GATCAGAATC TTTATCTGTG GATTTTTTTT AAAGATTTTA AAGAGCATTT TAATAATCAA GGTGTTTTAT GCATTTGTTA
GTGTTGGCCT ACGGCACCTT TTTGAAATAT GTTTTATTTT CTTCAGTTTC GACCATTGTT AGGACTATCA ACAAGATATT
TAGGACTTGC AAAGGTGCTC TATGTTTAAC AGAAATTTAA TTTACATTCT TTATCAGTTG GGCAAGTGGT GCTCTTGATC
CAGAAAGAAG CTTCTCTGTT GACCGCGTTT CATCTGTTAA AAGGTATTCT ACTCATCCAG GTTAGACGGT AGTTGTTTTT
ACCATTCACT CACTAATTGG ACATCTTTAA AACTAGTGTT ACCTGGTCAT CTGTGTTCAA AATATTTTTT ATTGAAATCA
CACGAGTCAG ATCCATAGCA GATTTCATGT GTTGATGTTT TTTTTGCTGC ACTAGACACG CAAATTCTAG TCGGTTTCCA
ACCACATGAG TGTTCATTTT ATTTTTACCA TCATTTTTCT CAACAATTTA TCTGTTGATT ATCATTTAAG GATTCCTTTT
TGTTGATATG TCATATGTTT CTCTTTTATT GACAGGGGTG TCTTTGCAAT GATTGCTGTT TTTTTGGCTT ATTCATTTCT
TCAGGCACCT TCTACGTGAG TCACATAAAC CCCTTATCCG AACTCTGATT ATCGAACTCT GTTTATGGTA GGGATGGCCG
TGCAGATATA AATAATGCTA TTGCACATTG ATATGGAACA GAAGGGGGTA CGCGTTCCTG CGTACTCCAT TTCTGAAAAT
AACTTTTCAA TATCACTGAG GAATTGTATC ATTTTCCTAG ATGTGTTACT TTTATCATGA AACTGAAATA ACTTCATAAA
TTCTCCTAAA TAACAGTTTT AATTTAAAAA TCCCTTGAAA GTGAGGCACT GTTCCATTTC CTAAAAATAT AACCTCATTG
GGGGCTTCTC TGTAATTTTG TTTAACATTT ACTTATATTT ATTTATACTA TGATTCAGTG TACTTATTAG ACCACATCCT
GCCATTTGGC GGCTGGTCCA CGGGATGGCA GTTGTTTACC TTGTTGCTCT AACTTTTTTG CTTTTCCAGG TAAGTACAGC
TTTTTCTTAT TACTCTTGCT CAACACATTT TTATTGGATC ATTGATATTC ATGGATTATT AAGGCATTGC ATTCTTTTAC
TTTTTTTATC TCTTCCACAT AACCTTATAA TATCAACTTC TTTTCTAATG AACGGCATAG AAGTCCCTGT CTCAGTTTCT
CGTTTAATTG ATTAGCATAA GGAATTGCAC TGTGCACTAA TACCTCACTT CCCTCTTGAT TCCAACCAAA AATAGGTTAT
TTTTATTAAA GGAAAAAAGA GTCGTCATTG GCATTACACA TCAGCAGCAG AAGATGAGGT TACCAATGTC AAAAGTTTAA
CAGTATAACT ATAGGTGAAC ATAGATCAGT TTGGAACTAG GATGACTCAA GAGATTAACA CACATTGGAA AGAAAAGCCT
GGTATCCCAT TTTTATGTTA CCCTGGGAAC TTTTTTAGTC AAtaggaagc ttcccagaaa tgttttcaag tcatccaact
aattgcgatt agtcatccta gtcggtacta aggcaacttg attctaacca cgattgatcg gaaagtctcc taattagtcg
cgattagtta tgattaatca tccTAGTCGG TACTGAGGTG ATTTTCCTCG AGTTTCCGAT TTGAAAACAT GCTGCCTTGT
TGTGGTTTAC TCCTAGAGGT AGCTAGTCAA AGTGCCAAGA GACTATTCTC CCGTATCTTT ACTATTGTGC TATACTGGTC
CATGTTGCAT GCACCAGATG AGACAATGTC TCAAAAAGTG AGGGTCTTGT TATAAATATT TTTTTTCTTC TCAAATACGC
AAGAGAATTG TGCATCATTG GTCTTGTTAT AAATATCATA AAAGAGAGAA CAAAACCTGT AGTTTGCATG GGATTCATAC
TCTGTTCCAC TTAATCTTGC AGACCCGTGA TGATGCTAGG CAATTTATGA AGTATCTTCA CCCTGATCTT GGTGTTGGTA
ATGAATTTAA TTTCCATATA TGATCTAGCA GTGCAGAGTT ATGTGATTGG AAAAATAAAA ACCTGATTTT TACCCACCTT
TGAGCAGAAT TACCTGAAAG ATCTTATGGA ACCGACTGCC GCATATATGT ACCTGATCAT CCGAAAAGCA GGTTTAACAA
TGTTTATGTA TGACTCCATT CACCAACTTG CTTCTCCTTT TTGTTCTATT TGATTTACCT TAAAACTCCA GTTCTGCAAA
GTCTTGGAGA TGCTTCAAGT TACTGATTTG AATATAGGTT TCTCTAGGAG ATCCTTTTTG ATGAGTTTGT TATTGCCCAT
ATCCTTGGAT GGTGGGGGAA GGCTATAATG ATAAGAAACC AACCACTTTT ATGGGTATTA TCAATTGGCT TTGAGCTAAT
GGAGGTATGC ATTTAATCTT ACACGATCAA TTTATTTTTG GCTTCTGTCT TCTGAATCTA GATTCCTTAC ATAGTTTCAC
ATGTCCTGCA GCTCACCTTT CGCCATATGC TGCCAAACTT TAATGAGTGT TGGTGGGATA GCATCGTACT AGACATATTA
ATCTGCAATT GGTTTGGTGA GATTTTTTAT ATTTTATCAG TATTTTTAAT ATACAATTCT CATTTCCTTT AAATGTAGAT
TAGACACCCT CATTCAGTTT ATTCAGAAAT CATTTTTTTG TTTATTGGCT TCTTTCTTTA TTGTGGTTGT ATAAGCTGCT
GGAGTAGTAT CTTCTGATTT ACTGAAACCT CATTCAGAAT TTTGTACCTT AGCATATTAA AGTTAATCAT GGCAAACCTA
TGTTTCACAT TGTTTTGCTT ATCTCTTTCT GCAAATCGCT AAGACAGAAT ATTAGTGTTT TAATAGTTTT GTGATGTATT
AGACATCTTT TAAATGCTAA GTGTACCTAT GGTATTTCAC TAGCTATTTC GTATGAAGTT GTGCGCTATA ATTGTTACTT
TAAATGCTAA GATATTTCAT GTGATTAAAA TTTCGGGACA GTTTTCATGC GAATGTCTGT CTTTACCTCT ATTCGTTAGC
CTCCCATAAG TTTGATTCTT CTCTGCTGCA ACATCGTGTT ATGTATCTTT TGCTTGAGTA ATAGAGTGAC AGTTGCTTTC
AACTCTTCCT GACTGGGACC CTTATTTGGT TTAGGTATTT GGGCTGGAAT GAAGACTGTG AGATACTTTG ATGGGAGGAC
ATATGAATGG GTTGGTTTGA GTCGTCAACC CAATATTATC AGTAAGGTAT GCTCATTAGA TGTCAAGGGG AATGAAGTTG
CCCAGCAAAG CATATGGTGG CATTATACTT TTCTTTTTTT TGGCATCTGT CCCATTTTTA TGCAGTGCAT TGTGTTGTAT
ATCTTGCCTT AGTATCATAT TAAGGTGATT AACTCTAATA CAGGTAGGAT TTACTGAGAA ACCAACACAA TTTGTCATTA
GTTGTCTAAT TAGCCCAATA TGCACCATAC TGTTAGGTAC CTGTAAATAC ATGTATAAAA TGAAAATATT ATGTGTGTGA
CGTTTATATC TTGACTTTCA AATCCGGTTT TTTCTATGCA TAGGTTAATA CCGTACTACG GTATAGTATT AAACTCAACC
ATTAATTTTT CCCTTGAATG TTATATGCTA TGTTCTGTAT TTCTAGTGCT TCGAATTATT TGTTCTTGAT CTTTATATTG
TTAGCCTTTC CCGTGAGTGC ATATTTCACC TTTTGCTTCT CCATAGGTAA AAAGGACGCT AGGCCAGTTC ACACCAGCAC
AGTGGGACAA AGATGAGTGG TACCCTCTGC TTGGCCCTTG GAGATTCATC CAGGTGCTGA GCCTATGTAT TGTTTTCATG
ATTGTTGAAC TTAACACATT CTTTCTCAAG TTCTGCCTTT GGATTCCTCC CCGAAACCCC TTGATTGTTT ACCGACTTGT
CCTTTGGTGG TTAATTGCGA TACCAACCAT TCGCGAGTAC AATACATACT TACAAGACAG GTGAATATTG AACTCCCTAA
GCTTCTTTTT TTGAATGTAT GAACTTAATT AGCTTCAAAC TGTAAAAAAA AATAAATCTC TAAGTATGTT TTGATGAGTT
GCTCTGTACT CATCCAGCAT TATCGACTGT TCAAGAACAG AAACTCTGGA TTTTCTTGGA TGCACTGTGC CTGCTATTAA
CTATTACTGC TTGACATGCT ACATGGCAGT GCAGATGTGC CACTATTTGT TGACCATAAA TATGTACCGT CTGCTAGACA
TTGGTTGCAT GTGAACTGTG TGTAGTATAG ACAGCATTCT AACTGCATGC TTACAATAGG ATCAAACAGC TTGGCTATAA
GTTCACAGAA TTCATACCCA TTAATAATAT AACTTGTCTG AATGATTGCA GGAAACCTGT TAAAAAGGTG GGGTCTTTCT
GTTGGCTTTC CCTAGCTATT TGCATTTTGG AGCTTCTACT ATGCATCAAG TTTGGACATG GTGAGTTTGA TGTAAATTTC
TTGATGCTTG CAAGCAACAT TTGCATCCTT AAAATTAACC GTTCTGAACA CGTTGGCTTG TGAACAGGTC TCTTTCCGAA
GTCGATGCCG TCATGGTTGT TCATAGCCTG GACGACCGTG GCGTCGCTTC TGATGATGTT CCTTCTTGTG TGGACTTGGA
AAATTTACCG AACAATGATA AGGAAAAGGC TATGATTCTT CTGTTGCTTT GCTCTCAATT CTTTCCTCCT CCATTCAATA
TTGTCGTGTA AATATTCATT CAAAAAAATC TGTACATGTG GTAGTAGCCA TTAATTTGGT GGTCTCGAGA AGGATCATCA
TAAGGAATTT TATGTCTTTG CCTTTGTATT CCATGAGCCA AAATGGCATT CCCTTTTCCT TCCTGTGATG TAACTCTGAC
AGCCAAACTT TAGTGTTCCT TTGGTCCAAT CTAATTCCTG GGAAATAATG AACCAAGATT TATTCT