Os01t0127200-01

Locus

Os01g0127200

Description

Multicopper oxidase, Maintenance of Pi homeostasis

RAP-DB Gene Symbol Synonym(s)

OsLPR5, OsSTA2

RAP-DB Gene Name Synonym(s)

Low Phosphate Root5

CGSNL Gene Symbol

LPR5

CGSNL Gene Name

LOW PHOSPHATE ROOT 5

Oryzabase Gene Symbol Synonym(s)

OsSTA2, STA2, OsLPR5

Oryzabase Gene Name Synonym(s)

Low Phosphate Root5, Low Phosphate Root 5

Transcript Evidence

AK243237

Protein Evidence

A2ZNT5

Literature

PMID: 27716044

Note

Manual Curation

October 6, 2016

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: copper ion binding (GO:0005507)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Cupredoxin (IPR008972)

Multicopper oxidase, type 3 (IPR011707)

Multicopper oxidase, type 1 (IPR001117)

Multicopper oxidase, type 2 (IPR011706)

Multicopper oxidase, copper-binding site (IPR002355)

Full-length cDNA

J100045I20 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0127200-01)

Others

Oryzabase (19320)

KEGG (Os01t0127200-01)

Transcript

2288 bp

>Os01t0127200-01 Multicopper oxidase, Maintenance of Pi homeostasis
GATCAGTCGATCAGCTAATCTCTTTCTCCTTTAATTCATTATCCTTTGCATGCCCCTCTC
CAGCTAGCTAAGATGAGTCCGAGGATTCAGCAGCTGGCCGCTGTGTTGTTGGCGGCTGTT
GTCGTCGTCGCAGCCGCCAGGGATGAACCTGCAGCAGCAAAAAATTACCAAACTCAATGG
GATACAGTAATGTCAATACTTAACTGTAAGAGTGATTCTTTAATCCCAAGCTACATCTGC
AGCGTGATTAGCAAAAGTCGCTGGGGTTGGGCGTCAGATGACCCCAACGACGACGAGTAC
ACACCACCGGATCATCCGCTGCCGGCGCCGGCGGCGGGGCGGCGGCGGTGGCCGGTGATG
ACGAGCTTGAACCTGACAAAGTACGTGGACTCGCTGCCGCGGATTGCCAAGATCCGGGGC
TACGGCATCCGCCATGGCCGTCCAGTGCCCATCAAGCTCACCATCGGCATGTACAGCAAG
ACATGGCAATTCCACCGCGACATGCCACCGACGCCGGTGTTCGTGTACGGGCAATCGCTG
CAGACAGCGACGTTCCCGGGGCCCACCATCGTGGCGCGGCAGGGCGTGCCGCTCGCCGTG
GAGTGGCAGAACCACCTCCCCGACGCCCACATCCTCCCGTGGGACCCCAAGGTCCCCACC
GCCATCCCCAAGAAGGGCGGCGTCCCCACCGTCGTTCACCTCCACGGCGGCGCCCACCCG
CCGGAGTTCGACGGCCACGCCTTCGCCTGGTTCACCCGCGACTTCGCCGAGAACGGCAGC
ACATGGACGCGGAAGACCTACACCTACCCCAACGTGCAGGCGCCGGGCAACCTCTGGTAC
CACGACCACGCCCTCGGCCTCACCCGCGTCAGCCTCCTCGCCGGCCTCCTCGCCGCCTAC
GTCATCGAGAAGCCCGAGCTCGAGGACCCCATGAACCTCCCCTGCGGCGACCACGACCTC
CACCTCGTCATCGCCGACCGCGAGTTCTACACCAATGGCTCCATCTCCATCGACCGGGAG
TGGAAGCCGGAGTACTTCGGCCTCGTCATCACCGTCAACGGCAAGGCGTGGCCGTACCTC
AGCGTCCAGCGCCGCCGCTACCGCCTCCGCATCCTCAACGCCAGCAACGCCAGATACTTC
AACGTCACGCTCTCCAATGGCGCCCTCCCCTTCACCGTCATTGGCTCCGACTCCTCCTAC
CTCTCCAGGCCGGTCACCGTCTCCAACCTCGTCCTCTCGCCGGCCGAGATCTTCGACGTC
ATCGTCGACTTCTCCCGGTTGCCGGCGGCGATGACCGAGATCGAGATGCTCAACACGGCG
CCCTACCCGTTCCCCAACGGCCCTAATGTGACGGACCCGAACCTCGACGGGAAGGTGATG
CTGTTCAAGGTCGCCGGCAAGGGGAAGGTCGACGACATGCCGGACAAATCCAAGGTGCCG
GAGCACGGCGTGCCGTACGCGAGCGTGGCGGCGCTCCCGCCGCCGACGACGACGAGGTAC
ATCGTCCTGTACGAGAACCAGACCGCGCCGGGGAACCTCTACATCAACGGCCTCCGGCTG
GAGGACCCGGTGACGGAGACGCCCAAGTCCGGCACGACGGAGCTGTGGCAGGTGATCAAC
CTCACCGGCGACAACCACCCGCTGCACCTCCACATTGCCACGTTCCAGGCCATCAAGATG
ACGAAGATCGAGGGATTCCAGGTGTTCAAGGACTGCATGATCAAAAACAACAACACCGCC
ACGTGCAACCTCGACCAGCACGCCGTCGGGCCCGTCGTGCCGGTGCCGGAGGAGGAGAAG
ACGTGGAAGAACGCGGTGAAGATTCCGCCGGAGTTCATGACGTCGGTGGTGGTGGCGTTC
AGGCTTGTCGAGGCCAATCAGCCCTACCCCTTCGACGCCACCACCGAGCCGGGATTCGTC
TACCACTGCCACATCCTGGATCACGAAGACAACGCCATGATCAGGCCTCTGAAGCTGCTT
CCATGAACAAGAAACGTAGTGCTGATCGATGAGAATATGAGATGAAGAAGCTTCTTCACT
AGGATTAATAATTCTGAGCATTTACGTTTGAGTGAAAGTTGTTTATGTTATGTTATCCAA
GTCTTTGTTTATGAGTGAAAGTTTGCTAGTCATAAACTGGTGCGCTCTGACGGGGTATCT
GTGCTACGGACTTAATTTGGGTTTGTACTTTATTGGAAGTTATATATGAATTATGTTGTT
GATTGTTGAAGTACACTGTACAAAATAATATAGCTTATTTCAggaaataaattttaatcc
ttcaaggg

CDS

1914 bp

>Os01t0127200-01 Multicopper oxidase, Maintenance of Pi homeostasis
ATGAGTCCGAGGATTCAGCAGCTGGCCGCTGTGTTGTTGGCGGCTGTTGTCGTCGTCGCA
GCCGCCAGGGATGAACCTGCAGCAGCAAAAAATTACCAAACTCAATGGGATACAGTAATG
TCAATACTTAACTGTAAGAGTGATTCTTTAATCCCAAGCTACATCTGCAGCGTGATTAGC
AAAAGTCGCTGGGGTTGGGCGTCAGATGACCCCAACGACGACGAGTACACACCACCGGAT
CATCCGCTGCCGGCGCCGGCGGCGGGGCGGCGGCGGTGGCCGGTGATGACGAGCTTGAAC
CTGACAAAGTACGTGGACTCGCTGCCGCGGATTGCCAAGATCCGGGGCTACGGCATCCGC
CATGGCCGTCCAGTGCCCATCAAGCTCACCATCGGCATGTACAGCAAGACATGGCAATTC
CACCGCGACATGCCACCGACGCCGGTGTTCGTGTACGGGCAATCGCTGCAGACAGCGACG
TTCCCGGGGCCCACCATCGTGGCGCGGCAGGGCGTGCCGCTCGCCGTGGAGTGGCAGAAC
CACCTCCCCGACGCCCACATCCTCCCGTGGGACCCCAAGGTCCCCACCGCCATCCCCAAG
AAGGGCGGCGTCCCCACCGTCGTTCACCTCCACGGCGGCGCCCACCCGCCGGAGTTCGAC
GGCCACGCCTTCGCCTGGTTCACCCGCGACTTCGCCGAGAACGGCAGCACATGGACGCGG
AAGACCTACACCTACCCCAACGTGCAGGCGCCGGGCAACCTCTGGTACCACGACCACGCC
CTCGGCCTCACCCGCGTCAGCCTCCTCGCCGGCCTCCTCGCCGCCTACGTCATCGAGAAG
CCCGAGCTCGAGGACCCCATGAACCTCCCCTGCGGCGACCACGACCTCCACCTCGTCATC
GCCGACCGCGAGTTCTACACCAATGGCTCCATCTCCATCGACCGGGAGTGGAAGCCGGAG
TACTTCGGCCTCGTCATCACCGTCAACGGCAAGGCGTGGCCGTACCTCAGCGTCCAGCGC
CGCCGCTACCGCCTCCGCATCCTCAACGCCAGCAACGCCAGATACTTCAACGTCACGCTC
TCCAATGGCGCCCTCCCCTTCACCGTCATTGGCTCCGACTCCTCCTACCTCTCCAGGCCG
GTCACCGTCTCCAACCTCGTCCTCTCGCCGGCCGAGATCTTCGACGTCATCGTCGACTTC
TCCCGGTTGCCGGCGGCGATGACCGAGATCGAGATGCTCAACACGGCGCCCTACCCGTTC
CCCAACGGCCCTAATGTGACGGACCCGAACCTCGACGGGAAGGTGATGCTGTTCAAGGTC
GCCGGCAAGGGGAAGGTCGACGACATGCCGGACAAATCCAAGGTGCCGGAGCACGGCGTG
CCGTACGCGAGCGTGGCGGCGCTCCCGCCGCCGACGACGACGAGGTACATCGTCCTGTAC
GAGAACCAGACCGCGCCGGGGAACCTCTACATCAACGGCCTCCGGCTGGAGGACCCGGTG
ACGGAGACGCCCAAGTCCGGCACGACGGAGCTGTGGCAGGTGATCAACCTCACCGGCGAC
AACCACCCGCTGCACCTCCACATTGCCACGTTCCAGGCCATCAAGATGACGAAGATCGAG
GGATTCCAGGTGTTCAAGGACTGCATGATCAAAAACAACAACACCGCCACGTGCAACCTC
GACCAGCACGCCGTCGGGCCCGTCGTGCCGGTGCCGGAGGAGGAGAAGACGTGGAAGAAC
GCGGTGAAGATTCCGCCGGAGTTCATGACGTCGGTGGTGGTGGCGTTCAGGCTTGTCGAG
GCCAATCAGCCCTACCCCTTCGACGCCACCACCGAGCCGGGATTCGTCTACCACTGCCAC
ATCCTGGATCACGAAGACAACGCCATGATCAGGCCTCTGAAGCTGCTTCCATGA

Protein

638 aa

>Os01t0127200-01 Multicopper oxidase, Maintenance of Pi homeostasis
MSPRIQQLAAVLLAAVVVVAAARDEPAAAKNYQTQWDTVMSILNCKSDSLIPSYICSVIS
KSRWGWASDDPNDDEYTPPDHPLPAPAAGRRRWPVMTSLNLTKYVDSLPRIAKIRGYGIR
HGRPVPIKLTIGMYSKTWQFHRDMPPTPVFVYGQSLQTATFPGPTIVARQGVPLAVEWQN
HLPDAHILPWDPKVPTAIPKKGGVPTVVHLHGGAHPPEFDGHAFAWFTRDFAENGSTWTR
KTYTYPNVQAPGNLWYHDHALGLTRVSLLAGLLAAYVIEKPELEDPMNLPCGDHDLHLVI
ADREFYTNGSISIDREWKPEYFGLVITVNGKAWPYLSVQRRRYRLRILNASNARYFNVTL
SNGALPFTVIGSDSSYLSRPVTVSNLVLSPAEIFDVIVDFSRLPAAMTEIEMLNTAPYPF
PNGPNVTDPNLDGKVMLFKVAGKGKVDDMPDKSKVPEHGVPYASVAALPPPTTTRYIVLY
ENQTAPGNLYINGLRLEDPVTETPKSGTTELWQVINLTGDNHPLHLHIATFQAIKMTKIE
GFQVFKDCMIKNNNTATCNLDQHAVGPVVPVPEEEKTWKNAVKIPPEFMTSVVVAFRLVE
ANQPYPFDATTEPGFVYHCHILDHEDNAMIRPLKLLP*

5'UTR

chr01:1500535..1500606 (- strand) : 72 bp

CDS

chr01:1499928..1500341 (- strand) : 414 bp

chr01:1497686..1499131 (- strand) : 1446 bp

chr01:1497543..1497596 (- strand) : 54 bp

3'UTR

chr01:1497241..1497542 (- strand) : 302 bp

FASTA

>Os01t0127200-01 class=Sequence position=chr01:1497241..1500606 (- strand)
GATCAGTCGA TCAGCTAATC TCTTTCTCCT TTAATTCATT ATCCTTTGCA TGCCCCTCTC CAGCTAGCTA AGGTGACAAA
AACTGACATC ACTGCTTGAT TAGCTACTTA ATTACTTATT TCGTCTTAAA ATATAGTTAT GTTTATTTTC AATTAGCTAC
GAATCTAAAT AGTACTGACA TTGCTGCACG ATATGGCCAG AAACTTAGAA TGCAATCAAC TATTGTAAAA TGTATACTGA
TTTTTGTCTT GTTGATTGCG TGCAGATGAG TCCGAGGATT CAGCAGCTGG CCGCTGTGTT GTTGGCGGCT GTTGTCGTCG
TCGCAGCCGC CAGGGATGAA CCTGCAGCAG CAAAAAATTA CCAAACTCAA TGGGATACAG TAATGTCAAT ACTTAACTGT
AAGAGTGATT CTTTAATCCC AAGCTACATC TGCAGCGTGA TTAGCAAAAG TCGCTGGGGT TGGGCGTCAG ATGACCCCAA
CGACGACGAG TACACACCAC CGGATCATCC GCTGCCGGCG CCGGCGGCGG GGCGGCGGCG GTGGCCGGTG ATGACGAGCT
TGAACCTGAC AAAGTACGTG GACTCGCTGC CGCGGATTGC CAAGATCCGG GGCTACGGCA TCCGCCATGG CCGTCCAGTG
CCCATCAAGC TCACCATCGG CATGTACAGC AAGACATGGG TACGTACGTT GTGATTACGg gaaaatatat atctaatatc
cagaccaacg tatatagtga agacatgtaa actaccatta aattaagaaa aatatatacg cttgagattt atccatatta
tcataagtaa aactgttatt catgattaaa tctgggagta aaaatttcaa ttttggtgtc atgaacaaat cttagatatt
tatttttaga tccaacAATA tactaccttc attttttatt agatgatata tatgactttt gaaattatgt ttgactattt
gtcttattac taaaaaataa taaataatgt aaatatgcta aaatTTACCG GTAAGAAAAT AAAAAAGGAC TACCTATATA
TGTGAAAGTT TCATATAAAT TATATTATAT ACTCCCTCTA TTTCAGTTAT ATACTCCCTC TATTTCAGTT ATAAGACATT
TTGACTTTGa gtcaaagtgc tctaagtttg attaagcttg taaaaatagc aataacattt tcaacccaag acaattttat
tatgaaaata tattcaatta ttgatttgat aaaaactagt ttagtattat taatattact atatttgtct atgaacttaa
ataaatttga aacagtttaa ttttgaccaa aGTCAGTACA TCTATAGAAG TTACAATGTA GCTATATTAT ACGGTTAAAT
ATATTTATGT CTATCGAACT TTCAAGAAAA AAAAAGAACT TTCAAGAAAA AAAATATCAA TAAACATGTA GCAAAATCGA
AAAATAATTT CAAAATGGGA TGCTTGCGCA TGCAGCAATT CCACCGCGAC ATGCCACCGA CGCCGGTGTT CGTGTACGGG
CAATCGCTGC AGACAGCGAC GTTCCCGGGG CCCACCATCG TGGCGCGGCA GGGCGTGCCG CTCGCCGTGG AGTGGCAGAA
CCACCTCCCC GACGCCCACA TCCTCCCGTG GGACCCCAAG GTCCCCACCG CCATCCCCAA GAAGGGCGGC GTCCCCACCG
TCGTTCACCT CCACGGCGGC GCCCACCCGC CGGAGTTCGA CGGCCACGCC TTCGCCTGGT TCACCCGCGA CTTCGCCGAG
AACGGCAGCA CATGGACGCG GAAGACCTAC ACCTACCCCA ACGTGCAGGC GCCGGGCAAC CTCTGGTACC ACGACCACGC
CCTCGGCCTC ACCCGCGTCA GCCTCCTCGC CGGCCTCCTC GCCGCCTACG TCATCGAGAA GCCCGAGCTC GAGGACCCCA
TGAACCTCCC CTGCGGCGAC CACGACCTCC ACCTCGTCAT CGCCGACCGC GAGTTCTACA CCAATGGCTC CATCTCCATC
GACCGGGAGT GGAAGCCGGA GTACTTCGGC CTCGTCATCA CCGTCAACGG CAAGGCGTGG CCGTACCTCA GCGTCCAGCG
CCGCCGCTAC CGCCTCCGCA TCCTCAACGC CAGCAACGCC AGATACTTCA ACGTCACGCT CTCCAATGGC GCCCTCCCCT
TCACCGTCAT TGGCTCCGAC TCCTCCTACC TCTCCAGGCC GGTCACCGTC TCCAACCTCG TCCTCTCGCC GGCCGAGATC
TTCGACGTCA TCGTCGACTT CTCCCGGTTG CCGGCGGCGA TGACCGAGAT CGAGATGCTC AACACGGCGC CCTACCCGTT
CCCCAACGGC CCTAATGTGA CGGACCCGAA CCTCGACGGG AAGGTGATGC TGTTCAAGGT CGCCGGCAAG GGGAAGGTCG
ACGACATGCC GGACAAATCC AAGGTGCCGG AGCACGGCGT GCCGTACGCG AGCGTGGCGG CGCTCCCGCC GCCGACGACG
ACGAGGTACA TCGTCCTGTA CGAGAACCAG ACCGCGCCGG GGAACCTCTA CATCAACGGC CTCCGGCTGG AGGACCCGGT
GACGGAGACG CCCAAGTCCG GCACGACGGA GCTGTGGCAG GTGATCAACC TCACCGGCGA CAACCACCCG CTGCACCTCC
ACATTGCCAC GTTCCAGGCC ATCAAGATGA CGAAGATCGA GGGATTCCAG GTGTTCAAGG ACTGCATGAT CAAAAACAAC
AACACCGCCA CGTGCAACCT CGACCAGCAC GCCGTCGGGC CCGTCGTGCC GGTGCCGGAG GAGGAGAAGA CGTGGAAGAA
CGCGGTGAAG ATTCCGCCGG AGTTCATGAC GTCGGTGGTG GTGGCGTTCA GGCTTGTCGA GGCCAATCAG CCCTACCCCT
TCGACGCCAC CACCGAGCCG GGATTCGTCT ACCACTGCCA CGTAAGCGCC ACGTCATATG CTCGACGTGC CCGTTCGTTA
TCGTGTTCAT TGATCAGTTG CTCCATTTCT AATTTATTTT GACTGTGCAG ATCCTGGATC ACGAAGACAA CGCCATGATC
AGGCCTCTGA AGCTGCTTCC ATGAACAAGA AACGTAGTGC TGATCGATGA GAATATGAGA TGAAGAAGCT TCTTCACTAG
GATTAATAAT TCTGAGCATT TACGTTTGAG TGAAAGTTGT TTATGTTATG TTATCCAAGT CTTTGTTTAT GAGTGAAAGT
TTGCTAGTCA TAAACTGGTG CGCTCTGACG GGGTATCTGT GCTACGGACT TAATTTGGGT TTGTACTTTA TTGGAAGTTA
TATATGAATT ATGTTGTTGA TTGTTGAAGT ACACTGTACA AAATAATATA GCTTATTTCA ggaaataaat tttaatcctt
caaggg

Locus: Os01g0127200

Loading...

Locus: Os01g0127200

Loading...