Os01t0129200-01

Locus

Os01g0129200

Description

C2H2 zinc-finger transcription factor, Floral organ identity, Cellular proliferation

RAP-DB Gene Symbol Synonym(s)

SL1, sl1(t), sl1, stl1, opb, OPB1, ps, PS, OPB

RAP-DB Gene Name Synonym(s)

STAMENLESS 1, stamenless1, stamenless 1, stamenless-1, open break, pistilloid-stamen

CGSNL Gene Symbol

SL1

CGSNL Gene Name

STAMENLESS 1

Oryzabase Gene Symbol Synonym(s)

sl1(t), sl1, stl1, opb, OPB1, ps, PS, OPB, DLN2, OsDLN2

Oryzabase Gene Name Synonym(s)

stamenless1, stamenless 1, stamenless-1, open break, pistilloid-stamen, DLN repressor 2, DLN motif protein 2

Transcript Evidence

EU443151 (Genbank)

AB297789 (Genbank)

Protein Evidence

Q9LG97 (UniProt)

Literature

PMID: 19453444

PMID: 19207212

Note

Manual Curation

September 17, 2009

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, C2H2 (IPR007087)

Zinc finger, C2H2-like (IPR015880)

Expression Databases

TENOR (Os01t0129200-01)

Others

Oryzabase (2122)

Transcript

792 bp

>Os01t0129200-01 C2H2 zinc-finger transcription factor, Floral organ identity, Cellular proliferation
ATGAACTCATCAAGGAGACAAGAAGGGAGCCCCCTGGACCTGAACAACCTGCCGGATGAG
TTCGGCAAGCAAACGGTGGAGAGCTCAACGACCACCGCCGCATCCAGCGCCGAAGCATCC
AGGGTTACTAAGAAGAAGAGTAATGGAGGGAAGGATGAAGCTGGCAAGGTGTACGAGTGT
AGGTTCTGCTCCCTCAAGTTCTGCAAATCTCAAGCGCTGGGTGGCCACATGAATCGCCAC
CGCCAAGAGAGGGAGACCGAAACCCTCAACCGCGCCAGGCAGCTCGTCTTCGGCAACGAC
AGCCTCGCCGCCGTCGGCGCACAGCTCAATTTCAGGGATGTGAACATGGGAGGAGGCGGC
GCCGCTGCTCCTCCACCGACGATGCAGATGGGAGGAGGAGGCTTCCGGGGAGGCGGTGTC
GGCGGCGACCCGTGCATCCCGCTCCGGCCGGTGCAGCCACGGCTGTCGCCGCCGCAGCCG
CCGCCGTACCACCACTACCTCTACACGACGACGGCGCCGCCGTCCGCCTTGCACCCGATG
AGCTACCCGGCGACGTACCCGGCCCCGCCGCGCCACCAGCAGCCGGCGGCGGTCGGCGAC
TACGTCATCGGCCACGCCGTCTCCGCCGGCGACGCGCTGGTGGCCCCGCCGCCGCCGCCG
CACCGCGCCAGCTTCTCCTGCTTCGGGGCGCCGCTCGCCGCGCCGCCGGCGAACGTGCAG
CCCGACAACGGCAACTGCAACTGCAGCTTCGGGTGCGGCCACAGCAACAGGAACGTGAAC
GCCGCCTCCTGA

CDS

792 bp

>Os01t0129200-01 C2H2 zinc-finger transcription factor, Floral organ identity, Cellular proliferation
ATGAACTCATCAAGGAGACAAGAAGGGAGCCCCCTGGACCTGAACAACCTGCCGGATGAG
TTCGGCAAGCAAACGGTGGAGAGCTCAACGACCACCGCCGCATCCAGCGCCGAAGCATCC
AGGGTTACTAAGAAGAAGAGTAATGGAGGGAAGGATGAAGCTGGCAAGGTGTACGAGTGT
AGGTTCTGCTCCCTCAAGTTCTGCAAATCTCAAGCGCTGGGTGGCCACATGAATCGCCAC
CGCCAAGAGAGGGAGACCGAAACCCTCAACCGCGCCAGGCAGCTCGTCTTCGGCAACGAC
AGCCTCGCCGCCGTCGGCGCACAGCTCAATTTCAGGGATGTGAACATGGGAGGAGGCGGC
GCCGCTGCTCCTCCACCGACGATGCAGATGGGAGGAGGAGGCTTCCGGGGAGGCGGTGTC
GGCGGCGACCCGTGCATCCCGCTCCGGCCGGTGCAGCCACGGCTGTCGCCGCCGCAGCCG
CCGCCGTACCACCACTACCTCTACACGACGACGGCGCCGCCGTCCGCCTTGCACCCGATG
AGCTACCCGGCGACGTACCCGGCCCCGCCGCGCCACCAGCAGCCGGCGGCGGTCGGCGAC
TACGTCATCGGCCACGCCGTCTCCGCCGGCGACGCGCTGGTGGCCCCGCCGCCGCCGCCG
CACCGCGCCAGCTTCTCCTGCTTCGGGGCGCCGCTCGCCGCGCCGCCGGCGAACGTGCAG
CCCGACAACGGCAACTGCAACTGCAGCTTCGGGTGCGGCCACAGCAACAGGAACGTGAAC
GCCGCCTCCTGA

Protein

264 aa

>Os01t0129200-01 C2H2 zinc-finger transcription factor, Floral organ identity, Cellular proliferation
MNSSRRQEGSPLDLNNLPDEFGKQTVESSTTTAASSAEASRVTKKKSNGGKDEAGKVYEC
RFCSLKFCKSQALGGHMNRHRQERETETLNRARQLVFGNDSLAAVGAQLNFRDVNMGGGG
AAAPPPTMQMGGGGFRGGGVGGDPCIPLRPVQPRLSPPQPPPYHHYLYTTTAPPSALHPM
SYPATYPAPPRHQQPAAVGDYVIGHAVSAGDALVAPPPPPHRASFSCFGAPLAAPPANVQ
PDNGNCNCSFGCGHSNRNVNAAS*

CDS

chr01:1625159..1625279 (+ strand) : 121 bp

chr01:1625530..1625653 (+ strand) : 124 bp

chr01:1625899..1625982 (+ strand) : 84 bp

chr01:1626112..1626574 (+ strand) : 463 bp

FASTA

>Os01t0129200-01 class=Sequence position=chr01:1625159..1626574 (+ strand)
ATGAACTCAT CAAGGAGACA AGAAGGGAGC CCCCTGGACC TGAACAACCT GCCGGATGAG TTCGGCAAGC AAACGGTGGA
GAGCTCAACG ACCACCGCCG CATCCAGCGC CGAAGCATCC AGTAAGGATA TCACTGCAAC ATTCATAACC AGCAAATGCT
AGTACATATA TAGCTTTAAT GTAGAGTAAA AAAGATAGAT TTTTGTTTTG TGTGTGTGTC TGAATGTGGT CATCTACTTA
AAATTTTCTC CTGAACCGTC TCGATCATTA CATGGAAAAA AGAAAACCTT AATTGTTGCA TTTTAGATAA AGGAAGTACA
GTTACATAGC TTCAGAATGG GATAACTGAA TGATTAGCTA ATTGTTTACA GGGGTTACTA AGAAGAAGAG TAATGGAGGG
AAGGATGAAG CTGGCAAGGT GTACGAGTGT AGGTTCTGCT CCCTCAAGTT CTGCAAATCT CAAGCGCTGG GTGGCCACAT
GAATCGCCAC CGCCAAGGCA ATATCACACA ACAACCTACC TAGCTATATA ATCGATATTT TTTTTATCAA AGAACCAATT
TGATCGATCA CAAATATATG AAGAAGTTCG TTTTTTTTAT CTTCCACGCA TCTAATATAT TCTAATCCAA CAGTAACCAT
TTATATCCTT AAGAAAAAGA TTCAATTTTT TGATCTTCCA TGCATCTAAT CTCGCATTCC CTTTGCCTCT AACTTGTGGG
ATATTGGGAT TTGATCTTTC AGAGAGGGAG ACCGAAACCC TCAACCGCGC CAGGCAGCTC GTCTTCGGCA ACGACAGCCT
CGCCGCCGTC GGCGCACAGC TCAAGTATGC ATATCACATC GATCGATCTA AGCGTGAATT AAATCTCCAT TAATTTGCAA
GTTGTGTCGT CTCGCCCGAT CCTTCCTTTC TCATCATCGA CTAGGGTTTC TTATGAAAGC TTTCTTGCTA CAGTTTCAGG
GATGTGAACA TGGGAGGAGG CGGCGCCGCT GCTCCTCCAC CGACGATGCA GATGGGAGGA GGAGGCTTCC GGGGAGGCGG
TGTCGGCGGC GACCCGTGCA TCCCGCTCCG GCCGGTGCAG CCACGGCTGT CGCCGCCGCA GCCGCCGCCG TACCACCACT
ACCTCTACAC GACGACGGCG CCGCCGTCCG CCTTGCACCC GATGAGCTAC CCGGCGACGT ACCCGGCCCC GCCGCGCCAC
CAGCAGCCGG CGGCGGTCGG CGACTACGTC ATCGGCCACG CCGTCTCCGC CGGCGACGCG CTGGTGGCCC CGCCGCCGCC
GCCGCACCGC GCCAGCTTCT CCTGCTTCGG GGCGCCGCTC GCCGCGCCGC CGGCGAACGT GCAGCCCGAC AACGGCAACT
GCAACTGCAG CTTCGGGTGC GGCCACAGCA ACAGGAACGT GAACGCCGCC TCCTGA

Locus: Os01g0129200

Loading...

Locus: Os01g0129200

Loading...