Os01t0135700-01

Locus

Os01g0135700

Description

Calmodulin-like protein, Calcium signalling during abiotic stress, Promotion of root growth and drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsCML16

RAP-DB Gene Name Synonym(s)

CALMODULIN-LIKE PROTEIN 16, calmodulin-like protein 16

CGSNL Gene Symbol

CML16

CGSNL Gene Name

CALMODULIN-LIKE PROTEIN 16

Oryzabase Gene Symbol Synonym(s)

OsCML16

Oryzabase Gene Name Synonym(s)

calmodulin-like protein 16

Transcript Evidence

AK062711

Protein Evidence

Q5ZCK5

Literature

PMID: 28244201

PMID: 17263873

Note

Manual Curation

December 11, 2018

Gene Ontology (GO)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

EF-hand domain pair (IPR011992)

EF-hand domain (IPR002048)

EF-Hand 1, calcium-binding site (IPR018247)

Full-length cDNA

001-106-C02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0135700-01)

RiceXPro (AK062711)

Others

Oryzabase (10502)

KEGG (Os01t0135700-01)

Transcript

889 bp

>Os01t0135700-01 Calmodulin-like protein, Calcium signalling during abiotic stress, Promotion of root growth and drought tolerance
CTAGCTCACCACAGCCACACTTCTGATCACTGCTCACTCAGCTAATTAAGCTCAAGCTTT
TGCTTACGGCAAGTCTTGCAACCATGTCGAACACCACCGAGAAGAAGATGCCGCAGCAGC
AGCAGGTTGAGAGGCCGACGGCGTTGGCGCCGGCGGACGCGGAGATCGAGAGGGTCTTCA
CCCGCTTCGACGCGGACGGGGACGGCAGGATCTCCCCCTCGGAGCTGGCCGCGGTGACGC
GCGCCATCGCGCCGCCGCCCAGCGAGTCCGCCGGCGGCCGCGAGGTGGCCGCCATGATGA
ACGAGCTCGACACCGACCGCGACGGCTTCGTCGACCTCGGCGAGTTCGCGGCGTTCCACG
GCCGCGGGCGCGGGGACGCCGAGCACGAGGCCGAGCTGCGCGCCGCGTTCGACGTGTACG
ACGTCGAcggcgacggccgcatcacggcggccgagctcggcaaggtcctcggccggatcg
gcgagggctgcagcgccgaggagtgcgagaggatgatcgcctccgtcgacgtcgacggcg
atggctgcgtcgggttcgaGGAGTTCAAGAAGATGATGTGCCGTGATGCCGCTGCAACCG
GCGGCGCTGACAAGGCCAAGACGGAGTAAAACAGTGTCAGGTCATCTAGATGTGCTCGCT
TCTGTTTGTCATTATTTTGACCTAGAAATGATGTAATAAAAGGGTAGTAATATCGATCTG
AATCCATGAGACCATGACTGATGCTTCCATGTGTAATTAGCAGCGCCGTGTATATTATTA
TATGTGATTATGTGTACACCGATCTGCTGATGTATGCTACTTTGATCTGGACCAGCTAAG
ATTTGGCCGAACTTTTAATGACAGAATTGCTGGTCATCTTCTCTTCCAC

CDS

546 bp

>Os01t0135700-01 Calmodulin-like protein, Calcium signalling during abiotic stress, Promotion of root growth and drought tolerance
ATGTCGAACACCACCGAGAAGAAGATGCCGCAGCAGCAGCAGGTTGAGAGGCCGACGGCG
TTGGCGCCGGCGGACGCGGAGATCGAGAGGGTCTTCACCCGCTTCGACGCGGACGGGGAC
GGCAGGATCTCCCCCTCGGAGCTGGCCGCGGTGACGCGCGCCATCGCGCCGCCGCCCAGC
GAGTCCGCCGGCGGCCGCGAGGTGGCCGCCATGATGAACGAGCTCGACACCGACCGCGAC
GGCTTCGTCGACCTCGGCGAGTTCGCGGCGTTCCACGGCCGCGGGCGCGGGGACGCCGAG
CACGAGGCCGAGCTGCGCGCCGCGTTCGACGTGTACGACGTCGAcggcgacggccgcatc
acggcggccgagctcggcaaggtcctcggccggatcggcgagggctgcagcgccgaggag
tgcgagaggatgatcgcctccgtcgacgtcgacggcgatggctgcgtcgggttcgaGGAG
TTCAAGAAGATGATGTGCCGTGATGCCGCTGCAACCGGCGGCGCTGACAAGGCCAAGACG
GAGTAA

Protein

182 aa

>Os01t0135700-01 Calmodulin-like protein, Calcium signalling during abiotic stress, Promotion of root growth and drought tolerance
MSNTTEKKMPQQQQVERPTALAPADAEIERVFTRFDADGDGRISPSELAAVTRAIAPPPS
ESAGGREVAAMMNELDTDRDGFVDLGEFAAFHGRGRGDAEHEAELRAAFDVYDVDGDGRI
TAAELGKVLGRIGEGCSAEECERMIASVDVDGDGCVGFEEFKKMMCRDAAATGGADKAKT
E*

5'UTR

chr01:1931822..1931904 (- strand) : 83 bp

CDS

chr01:1931276..1931821 (- strand) : 546 bp

3'UTR

chr01:1931016..1931275 (- strand) : 260 bp

FASTA

>Os01t0135700-01 class=Sequence position=chr01:1931016..1931904 (- strand)
CTAGCTCACC ACAGCCACAC TTCTGATCAC TGCTCACTCA GCTAATTAAG CTCAAGCTTT TGCTTACGGC AAGTCTTGCA
ACCATGTCGA ACACCACCGA GAAGAAGATG CCGCAGCAGC AGCAGGTTGA GAGGCCGACG GCGTTGGCGC CGGCGGACGC
GGAGATCGAG AGGGTCTTCA CCCGCTTCGA CGCGGACGGG GACGGCAGGA TCTCCCCCTC GGAGCTGGCC GCGGTGACGC
GCGCCATCGC GCCGCCGCCC AGCGAGTCCG CCGGCGGCCG CGAGGTGGCC GCCATGATGA ACGAGCTCGA CACCGACCGC
GACGGCTTCG TCGACCTCGG CGAGTTCGCG GCGTTCCACG GCCGCGGGCG CGGGGACGCC GAGCACGAGG CCGAGCTGCG
CGCCGCGTTC GACGTGTACG ACGTCGAcgg cgacggccgc atcacggcgg ccgagctcgg caaggtcctc ggccggatcg
gcgagggctg cagcgccgag gagtgcgaga ggatgatcgc ctccgtcgac gtcgacggcg atggctgcgt cgggttcgaG
GAGTTCAAGA AGATGATGTG CCGTGATGCC GCTGCAACCG GCGGCGCTGA CAAGGCCAAG ACGGAGTAAA ACAGTGTCAG
GTCATCTAGA TGTGCTCGCT TCTGTTTGTC ATTATTTTGA CCTAGAAATG ATGTAATAAA AGGGTAGTAA TATCGATCTG
AATCCATGAG ACCATGACTG ATGCTTCCAT GTGTAATTAG CAGCGCCGTG TATATTATTA TATGTGATTA TGTGTACACC
GATCTGCTGA TGTATGCTAC TTTGATCTGG ACCAGCTAAG ATTTGGCCGA ACTTTTAATG ACAGAATTGC TGGTCATCTT
CTCTTCCAC

Locus: Os01g0135700

Loading...

Locus: Os01g0135700

Loading...