Os01t0136100-01

Locus

Os01g0136100

Description

16.9 kDa class I heat shock protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HSP16.9A

CGSNL Gene Name

16.9 KDA CLASS I HEAT SHOCK PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

Oshsp16.9A, OsHsp16.9A, HSP16.9A, OsHSP16.9A-CI

Oryzabase Gene Name Synonym(s)

16.9 kDa class I heat shock protein 1, 16.9 kDa heat shock protein 1

Transcript Evidence

AK242299 (DDBJ, Best hit)

Protein Evidence

P27777 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Heat shock protein Hsp20 (IPR002068)

HSP20-like chaperone (IPR008978)

Full-length cDNA

J075192I02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0136100-01)

Others

Oryzabase (6161)

Transcript

815 bp

>Os01t0136100-01 16.9 kDa class I heat shock protein 1.
ACCGAGGAACACACAACAAACAAGACTTGCATACGTCCCAAACTCCCAAATCGCCCTCTT
TGCAATCGCTTCTTCCGTTCCATTTCAGTAGCCCACAACTTCGCATCAGAAAGCGAAAGA
TAGAGCAACCATGTCGCTGGTGAGGCGCAGCAACGTGTTCGACCCATTCTCCCTCGACCT
CTGGGACCCCTTCGACAGCGTGTTCCGCTCCGTCGTCCCGGCCACCTCCGACAACGACAC
CGCCGCCTTCGCCAACGCCCGCATCGACTGGAAGGAGACGCCGGAGTCGCACGTCTTCAA
Ggccgacctccccggcgtcaagaaggaggaggtgaaggtggaggtggaggaaggcaacgt
gctggtgatcagcggccagcgcagcaaggagaaggaggacaagaacgacaagtggcaccg
cgtggagcgcagcagcgggcagttcatgcggcggttcaggctgccggagaacgccaAGGT
GGACCAGGTGAAGGCCGGACTGGAGAACGGCGTGCTCACTGTCACCGTGCCCAAGGCCGA
GGTCAAGAAGCCTGAGGTGAAGGCCATTGAGATCTCCGGTTAAGCTCCTGAAGATGTGAT
CGGTGAGGGAAGAAGTCATGTTTGGTGTCAGTAATTCAGTATTTCAGTGTGTGTTTGTTT
GGTCGTGCAAGTATGGTCTGCTGCTGGTGTGTCGTACCCGTTGGGAGTCCGAGTGGCTGA
GTCGGCCGGTTTCATGTATTCCTTTGTGAGTACTTGTGTAATCGCCTTCTTAGTTCTTGC
TCGTTGAGGAATAAATAAAGAGCTTTTCAGGTTGC

CDS

453 bp

>Os01t0136100-01 16.9 kDa class I heat shock protein 1.
ATGTCGCTGGTGAGGCGCAGCAACGTGTTCGACCCATTCTCCCTCGACCTCTGGGACCCC
TTCGACAGCGTGTTCCGCTCCGTCGTCCCGGCCACCTCCGACAACGACACCGCCGCCTTC
GCCAACGCCCGCATCGACTGGAAGGAGACGCCGGAGTCGCACGTCTTCAAGgccgacctc
cccggcgtcaagaaggaggaggtgaaggtggaggtggaggaaggcaacgtgctggtgatc
agcggccagcgcagcaaggagaaggaggacaagaacgacaagtggcaccgcgtggagcgc
agcagcgggcagttcatgcggcggttcaggctgccggagaacgccaAGGTGGACCAGGTG
AAGGCCGGACTGGAGAACGGCGTGCTCACTGTCACCGTGCCCAAGGCCGAGGTCAAGAAG
CCTGAGGTGAAGGCCATTGAGATCTCCGGTTAA

Protein

151 aa

>Os01t0136100-01 16.9 kDa class I heat shock protein 1.
MSLVRRSNVFDPFSLDLWDPFDSVFRSVVPATSDNDTAAFANARIDWKETPESHVFKADL
PGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSSGQFMRRFRLPENAKVDQV
KAGLENGVLTVTVPKAEVKKPEVKAIEISG*

5'UTR

chr01:1949458..1949587 (- strand) : 130 bp

CDS

chr01:1949005..1949457 (- strand) : 453 bp

3'UTR

chr01:1948773..1949004 (- strand) : 232 bp

FASTA

>Os01t0136100-01 class=Sequence position=chr01:1948773..1949587 (- strand)
ACCGAGGAAC ACACAACAAA CAAGACTTGC ATACGTCCCA AACTCCCAAA TCGCCCTCTT TGCAATCGCT TCTTCCGTTC
CATTTCAGTA GCCCACAACT TCGCATCAGA AAGCGAAAGA TAGAGCAACC ATGTCGCTGG TGAGGCGCAG CAACGTGTTC
GACCCATTCT CCCTCGACCT CTGGGACCCC TTCGACAGCG TGTTCCGCTC CGTCGTCCCG GCCACCTCCG ACAACGACAC
CGCCGCCTTC GCCAACGCCC GCATCGACTG GAAGGAGACG CCGGAGTCGC ACGTCTTCAA Ggccgacctc cccggcgtca
agaaggagga ggtgaaggtg gaggtggagg aaggcaacgt gctggtgatc agcggccagc gcagcaagga gaaggaggac
aagaacgaca agtggcaccg cgtggagcgc agcagcgggc agttcatgcg gcggttcagg ctgccggaga acgccaAGGT
GGACCAGGTG AAGGCCGGAC TGGAGAACGG CGTGCTCACT GTCACCGTGC CCAAGGCCGA GGTCAAGAAG CCTGAGGTGA
AGGCCATTGA GATCTCCGGT TAAGCTCCTG AAGATGTGAT CGGTGAGGGA AGAAGTCATG TTTGGTGTCA GTAATTCAGT
ATTTCAGTGT GTGTTTGTTT GGTCGTGCAA GTATGGTCTG CTGCTGGTGT GTCGTACCCG TTGGGAGTCC GAGTGGCTGA
GTCGGCCGGT TTCATGTATT CCTTTGTGAG TACTTGTGTA ATCGCCTTCT TAGTTCTTGC TCGTTGAGGA ATAAATAAAG
AGCTTTTCAG GTTGC