Os01t0140700-01

Locus

Os01g0140700

Description

RAV family protein, Negative regulation of the transition from vegetative to reproductive phase, Maintenance of the vegetative state of the apical meristem

RAP-DB Gene Symbol Synonym(s)

OsRAV8

RAP-DB Gene Name Synonym(s)

RELATED TO ABI3 AND VP1 8

CGSNL Gene Symbol

AP2/EREBP77

CGSNL Gene Name

APETALA2/ETHYLENE-RESPONSIVE ELEMENT BINDING PROTEIN 77

Oryzabase Gene Symbol Synonym(s)

AP2/EREBP#077, OsRAV1, RAV1, OsRAV8, RAV8

Oryzabase Gene Name Synonym(s)

APETALA2/ethylene-responsive element binding protein 77, related to ABI3/VP1-1, RAV subfamily member 1

Transcript Evidence

Inferred from literature

Protein Evidence

Q9AWS7

Literature

PMID: 32554473

Note

Manual Curation

June 23, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

DNA-binding domain superfamily (IPR016177)

AP2/ERF domain superfamily (IPR036955)

DNA-binding pseudobarrel domain superfamily (IPR015300)

AP2/ERF domain (IPR001471)

B3 DNA binding domain (IPR003340)

Expression Databases

TENOR (Os01t0140700-00)

Others

Oryzabase (10642)

Transcript

1669 bp

>Os01t0140700-01 RAV family protein, Negative regulation of the transition from vegetative to reproductive phase, Maintenance of the vegetative state of the apical meristem
ATGGAGCAAGAAGCTGCCATGGTCGTCTTCTCCTGCAACTCCGGCTCCGGTGGGTCGTCG
TCGACGACCGATTCAAAGCAAGAGGAGGAGGAGGAGGAGGAGTTGGCCGCAATGGAGGAA
GACGAGTTGATCCACGTCGTCCAGGCGGCGGAGCTGCGGCTGCCGTCGTCGACGACGGCG
ACGCGGCCGTCGTCGCGGTACAAGGGGGTGGTGCCGCAGCCGAACGGGCGGTGGGGGGCG
CAGATCTACGAGCGGCACGCGCGGGTGTGGCTCGGGACGTTCCCCGACGAGGAGGCGGCG
GCGCGCGCCTACGACGTGGCGGCGCTCCGCTTCCGGGGGCGCGACGCCGTCACCAACCGC
GCCCCGGCGGCGGAGGGCGCGTCCGCCGGCGAGCTCGCGTTCCTGGCCGCGCACTCCAAG
GCGGAGGTCGTGGACATGCTGCGGAAGCACACCTACGACGACGAGCTCCAGCAGGGCCTC
CGCCGCGGCTCGCGCGCGCAGCCGACGCCGCGGTGGGCGCGCGAGCCGCTGTTCGAGAAG
GCCGTGACGCCGAGCGACGTCGGCAAGCTCAACCGCCTCGTGGTGCCCAAGCAGCAGGCC
GAGAGGCATTTCCCGTTCCCGCTCCGCCGCCACAGCTCCGACGCCGCCGGCAAGGGCGTG
CTCCTCAACTTCGAGGACGGCGACGGCAAGGTGTGGCGATTCCGGTACTCGTACTGGAAC
AGCAGCCAGAGTTACGTGCTCACCAAGGGGTGGAGCCGATTCGTGAGGGAGAAGGGCCTC
CGACCAGGCGACACCGTGGCCTTCTCCCGGTCGGCGGCGGCGTGGGGGACGGAGAAGCAC
CTCCTCATCGACTGCAAGAAGATGGAGAGGAACAACCTGGCAACCGTCGACGACGATGCC
CGTGTCGTCGTCAAGCTGTTCGGCGTTGACATCGCCGGAGACAAGACGAGGTAACACGCA
AGCGCAGCTAGCTGCATCGTATCGATCATATATATCACCCCGGCGCCTTCTTCTTCTTCT
TCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCA
CTTGTTCTTCGTTTTCTTCCTCTTCGATCTTCTCATTCATCTTCTGTTGCTGCCCTAGCT
ACAATGATCGATCGATGGATGATCCATATCATCGTTGATCCTTCGCTTCACATCAGGTTC
ATCATTCCTAGCTACATCGATATATGTACCTATAATTTGATGATGAGATGAACTTCTTCA
AAATTCAAATTAATCTCTGAAGAAACCAACGGAGAATTAGGATCAGAGTGTGCTAGCTAC
ATGTGAGCTAGAGATTAGAGAAATTTAAGAGTGTGTGTTATATGTAAATATATCGATCAT
TGCCAGATCGATCGAGGCGAAACTATAGAATTTTGCCTTGGGGTTTAATTAGCCTTAATT
TGTACCCAAAAATTGAAACAAATCCGTCCCACGCATTGCATTGGGATGTGTAATCCGGGT
TTCCATATGCATGGTTATGGGAATGTGCCATGTGTCTGCTATTGCTATATATAGTTATTA
GTCTAGCTACATTTCCAAATCACATGTTAAATTTGTTGTTCTCATAATGGATTCCTCTGT
TGGAGATGACTGTTCCTACAATATTATATTCGAACTTTTATGATCTCTT

CDS

954 bp

>Os01t0140700-01 RAV family protein, Negative regulation of the transition from vegetative to reproductive phase, Maintenance of the vegetative state of the apical meristem
ATGGAGCAAGAAGCTGCCATGGTCGTCTTCTCCTGCAACTCCGGCTCCGGTGGGTCGTCG
TCGACGACCGATTCAAAGCAAGAGGAGGAGGAGGAGGAGGAGTTGGCCGCAATGGAGGAA
GACGAGTTGATCCACGTCGTCCAGGCGGCGGAGCTGCGGCTGCCGTCGTCGACGACGGCG
ACGCGGCCGTCGTCGCGGTACAAGGGGGTGGTGCCGCAGCCGAACGGGCGGTGGGGGGCG
CAGATCTACGAGCGGCACGCGCGGGTGTGGCTCGGGACGTTCCCCGACGAGGAGGCGGCG
GCGCGCGCCTACGACGTGGCGGCGCTCCGCTTCCGGGGGCGCGACGCCGTCACCAACCGC
GCCCCGGCGGCGGAGGGCGCGTCCGCCGGCGAGCTCGCGTTCCTGGCCGCGCACTCCAAG
GCGGAGGTCGTGGACATGCTGCGGAAGCACACCTACGACGACGAGCTCCAGCAGGGCCTC
CGCCGCGGCTCGCGCGCGCAGCCGACGCCGCGGTGGGCGCGCGAGCCGCTGTTCGAGAAG
GCCGTGACGCCGAGCGACGTCGGCAAGCTCAACCGCCTCGTGGTGCCCAAGCAGCAGGCC
GAGAGGCATTTCCCGTTCCCGCTCCGCCGCCACAGCTCCGACGCCGCCGGCAAGGGCGTG
CTCCTCAACTTCGAGGACGGCGACGGCAAGGTGTGGCGATTCCGGTACTCGTACTGGAAC
AGCAGCCAGAGTTACGTGCTCACCAAGGGGTGGAGCCGATTCGTGAGGGAGAAGGGCCTC
CGACCAGGCGACACCGTGGCCTTCTCCCGGTCGGCGGCGGCGTGGGGGACGGAGAAGCAC
CTCCTCATCGACTGCAAGAAGATGGAGAGGAACAACCTGGCAACCGTCGACGACGATGCC
CGTGTCGTCGTCAAGCTGTTCGGCGTTGACATCGCCGGAGACAAGACGAGGTAA

Protein

318 aa

>Os01t0140700-01 RAV family protein, Negative regulation of the transition from vegetative to reproductive phase, Maintenance of the vegetative state of the apical meristem
MEQEAAMVVFSCNSGSGGSSSTTDSKQEEEEEEELAAMEEDELIHVVQAAELRLPSSTTA
TRPSSRYKGVVPQPNGRWGAQIYERHARVWLGTFPDEEAAARAYDVAALRFRGRDAVTNR
APAAEGASAGELAFLAAHSKAEVVDMLRKHTYDDELQQGLRRGSRAQPTPRWAREPLFEK
AVTPSDVGKLNRLVVPKQQAERHFPFPLRRHSSDAAGKGVLLNFEDGDGKVWRFRYSYWN
SSQSYVLTKGWSRFVREKGLRPGDTVAFSRSAAAWGTEKHLLIDCKKMERNNLATVDDDA
RVVVKLFGVDIAGDKTR*

CDS

chr01:2154326..2155279 (+ strand) : 954 bp

3'UTR

chr01:2155280..2155994 (+ strand) : 715 bp

FASTA

>Os01t0140700-01 class=Sequence position=chr01:2154326..2155994 (+ strand)
ATGGAGCAAG AAGCTGCCAT GGTCGTCTTC TCCTGCAACT CCGGCTCCGG TGGGTCGTCG TCGACGACCG ATTCAAAGCA
AGAGGAGGAG GAGGAGGAGG AGTTGGCCGC AATGGAGGAA GACGAGTTGA TCCACGTCGT CCAGGCGGCG GAGCTGCGGC
TGCCGTCGTC GACGACGGCG ACGCGGCCGT CGTCGCGGTA CAAGGGGGTG GTGCCGCAGC CGAACGGGCG GTGGGGGGCG
CAGATCTACG AGCGGCACGC GCGGGTGTGG CTCGGGACGT TCCCCGACGA GGAGGCGGCG GCGCGCGCCT ACGACGTGGC
GGCGCTCCGC TTCCGGGGGC GCGACGCCGT CACCAACCGC GCCCCGGCGG CGGAGGGCGC GTCCGCCGGC GAGCTCGCGT
TCCTGGCCGC GCACTCCAAG GCGGAGGTCG TGGACATGCT GCGGAAGCAC ACCTACGACG ACGAGCTCCA GCAGGGCCTC
CGCCGCGGCT CGCGCGCGCA GCCGACGCCG CGGTGGGCGC GCGAGCCGCT GTTCGAGAAG GCCGTGACGC CGAGCGACGT
CGGCAAGCTC AACCGCCTCG TGGTGCCCAA GCAGCAGGCC GAGAGGCATT TCCCGTTCCC GCTCCGCCGC CACAGCTCCG
ACGCCGCCGG CAAGGGCGTG CTCCTCAACT TCGAGGACGG CGACGGCAAG GTGTGGCGAT TCCGGTACTC GTACTGGAAC
AGCAGCCAGA GTTACGTGCT CACCAAGGGG TGGAGCCGAT TCGTGAGGGA GAAGGGCCTC CGACCAGGCG ACACCGTGGC
CTTCTCCCGG TCGGCGGCGG CGTGGGGGAC GGAGAAGCAC CTCCTCATCG ACTGCAAGAA GATGGAGAGG AACAACCTGG
CAACCGTCGA CGACGATGCC CGTGTCGTCG TCAAGCTGTT CGGCGTTGAC ATCGCCGGAG ACAAGACGAG GTAACACGCA
AGCGCAGCTA GCTGCATCGT ATCGATCATA TATATCACCC CGGCGCCTTC TTCTTCTTCT TCTTCTTCTT CTTCTTCTTC
TTCTTCTTCT TCTTCTTCTT CTTCTTCTTC TTCTTCTTCA CTTGTTCTTC GTTTTCTTCC TCTTCGATCT TCTCATTCAT
CTTCTGTTGC TGCCCTAGCT ACAATGATCG ATCGATGGAT GATCCATATC ATCGTTGATC CTTCGCTTCA CATCAGGTTC
ATCATTCCTA GCTACATCGA TATATGTACC TATAATTTGA TGATGAGATG AACTTCTTCA AAATTCAAAT TAATCTCTGA
AGAAACCAAC GGAGAATTAG GATCAGAGTG TGCTAGCTAC ATGTGAGCTA GAGATTAGAG AAATTTAAGA GTGTGTGTTA
TATGTAAATA TATCGATCAT TGCCAGATCG ATCGAGGCGA AACTATAGAA TTTTGCCTTG GGGTTTAATT AGCCTTAATT
TGTACCCAAA AATTGAAACA AATCCGTCCC ACGCATTGCA TTGGGATGTG TAATCCGGGT TTCCATATGC ATGGTTATGG
GAATGTGCCA TGTGTCTGCT ATTGCTATAT ATAGTTATTA GTCTAGCTAC ATTTCCAAAT CACATGTTAA ATTTGTTGTT
CTCATAATGG ATTCCTCTGT TGGAGATGAC TGTTCCTACA ATATTATATT CGAACTTTTA TGATCTCTT

Locus: Os01g0140700

Loading...

Locus: Os01g0140700

Loading...