Os01t0141600-01

Locus

Os01g0141600

Description

Protein of unknown function DUF647 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RUS5

CGSNL Gene Name

ROOT UV-B SENSITIVE 5

Oryzabase Gene Symbol Synonym(s)

OsRUS5

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK066922 (DDBJ, Best hit)

Protein Evidence

XP_002457390.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF647 (IPR006968)

Full-length cDNA

J013090N09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0141600-01)

RiceXPro (AK066922)

Others

Oryzabase (21450)

KEGG (Os01t0141600-01)

Transcript

1631 bp

>Os01t0141600-01 Protein of unknown function DUF647 family protein.
ACCCTTCCACTTCCACTCGCTGGCGATAGCACCGCACCGGAGCATATGCTCTCCGCAGCC
GCCGCCGCCGCCGCCGACGCGAGCTTCCATGGCGGAGCTCCCCGACGAAGAAGACCGCGG
CTACGCTCCTGCCTCGCGTCCCCGCCGGCATCCGGTGGAGGAGGAGGAGACTGCCGCGAG
TCCGAAAAAGCGAGACGTTTGCTCGTGGAGAGATACCAGGATGGGGTTTCCAAGAGGTAT
ATACTGGATGGAAACTCTAAGCTACAGATTCACCAGGAGAAGAATGAACATATGGCGAAC
ACATTGGAAGAAGAAGAAAAAGAAGAAGCAAATTCTTCGATTCCCCGTGCTATTAAGGAT
TTTGTACTTCCCGCGGGGTTTCCAGGGTCTGTGTCAGACGATTACCTGGAATATATGCTA
TGGCAATTACCAACAAATGTAACAGGATGGATCTGTCACACGCTGGTTACATCAACCCTT
CTAAAGGCTGTAGGTGTTGGGTCCTTTACAGGAACTTCAGCAGCTGCTTCTGCTGCTGCT
ATAAGATGGGTATCGAAAGATGGCATAGGGGCTTTTGGACGTCTTCTAATTGGTGGACGA
TTCGGAACTCTTTTTGATGATGACCCAAAGAAGTGGCGGATGTATGCCGATTTCATTGGA
AGTGCTGGAAGCATCTTCGAGCTCATCACTCCGCTCTATCCTGGATACTTCCTCCCACTT
GCGTCCTTGGGGAATCTAGCAAAGGCTGTAGGAAGAGGATTTAGGGATCCATCCTTCCGT
GTTATCCAAAATCACTTCGCGGAATCTGGAAATTTAGGGGAGGTTGCTGCAAAGGAGGAA
GTATGGGAAGTAGGAGCTCAGTTGTTAGGCCTTTCTATCGGTGTATTTATTATGGATACA
TCAGGTATAAAGTCATCATACCCAACACTTGCTTTGACATGGCTTGGTGTCCGTCTTCTA
CATCTTTGGTTTCGCTATCAGTCCCTATCAGTTCTCAAATTCCGCACAGTAAGGTAAACT
TGAAACGCGCTCGGATTCTCGTGAGATCACACGTTGCAAAGCACACAGTTCCTGATTATG
TGACTTGCAACGAGGAGGAGAATATTTTAACATGGGAAAGATTCTTGCATCCACAAATTT
CTTTTGGTGTTCCCATGGAGAGAATGCTTGGTGAAGAGGAATCCAGTGACGTGGTGGATA
GACTATTGAAGTTGTACAGAAATGAGAAATACATCCTCTTTCTCAATCCGATTGGAACAG
GCCGAGCAGCATTTTTTGTTACATTCAAGGAGGCTGCAACGAGCATGTCAGTCCTCAGGA
GCCTATGGCAAGCGCATTGGCTTGACAAAAATCAGCTAAGGCAGGATGATGTTTTCTCTT
GGCTAGAGGAGAGCGTTCTTGCGTTGGAGCACGGATTCCCTGACTTCCTCAAACAGATGG
AAATAGCTGGCTGGGATCAGAACCAGATCATACTGAAGGTGCCAAAAGAACCCATCATGG
TGATGGAACACCCTGACCAAGAGGTGTAAGATGACAATGCCAACTAACTAATCCATTCta
ctccctccgtgttttttaaatgtaaaggcgtattgacttttggacatggcgttagaccat
tcatctcatgc

CDS

972 bp

>Os01t0141600-01 Protein of unknown function DUF647 family protein.
ATGCTCTCCGCAGCCGCCGCCGCCGCCGCCGACGCGAGCTTCCATGGCGGAGCTCCCCGA
CGAAGAAGACCGCGGCTACGCTCCTGCCTCGCGTCCCCGCCGGCATCCGGTGGAGGAGGA
GGAGACTGCCGCGAGTCCGAAAAAGCGAGACGTTTGCTCGTGGAGAGATACCAGGATGGG
GTTTCCAAGAGGTATATACTGGATGGAAACTCTAAGCTACAGATTCACCAGGAGAAGAAT
GAACATATGGCGAACACATTGGAAGAAGAAGAAAAAGAAGAAGCAAATTCTTCGATTCCC
CGTGCTATTAAGGATTTTGTACTTCCCGCGGGGTTTCCAGGGTCTGTGTCAGACGATTAC
CTGGAATATATGCTATGGCAATTACCAACAAATGTAACAGGATGGATCTGTCACACGCTG
GTTACATCAACCCTTCTAAAGGCTGTAGGTGTTGGGTCCTTTACAGGAACTTCAGCAGCT
GCTTCTGCTGCTGCTATAAGATGGGTATCGAAAGATGGCATAGGGGCTTTTGGACGTCTT
CTAATTGGTGGACGATTCGGAACTCTTTTTGATGATGACCCAAAGAAGTGGCGGATGTAT
GCCGATTTCATTGGAAGTGCTGGAAGCATCTTCGAGCTCATCACTCCGCTCTATCCTGGA
TACTTCCTCCCACTTGCGTCCTTGGGGAATCTAGCAAAGGCTGTAGGAAGAGGATTTAGG
GATCCATCCTTCCGTGTTATCCAAAATCACTTCGCGGAATCTGGAAATTTAGGGGAGGTT
GCTGCAAAGGAGGAAGTATGGGAAGTAGGAGCTCAGTTGTTAGGCCTTTCTATCGGTGTA
TTTATTATGGATACATCAGGTATAAAGTCATCATACCCAACACTTGCTTTGACATGGCTT
GGTGTCCGTCTTCTACATCTTTGGTTTCGCTATCAGTCCCTATCAGTTCTCAAATTCCGC
ACAGTAAGGTAA

Protein

324 aa

>Os01t0141600-01 Protein of unknown function DUF647 family protein.
MLSAAAAAAADASFHGGAPRRRRPRLRSCLASPPASGGGGGDCRESEKARRLLVERYQDG
VSKRYILDGNSKLQIHQEKNEHMANTLEEEEKEEANSSIPRAIKDFVLPAGFPGSVSDDY
LEYMLWQLPTNVTGWICHTLVTSTLLKAVGVGSFTGTSAAASAAAIRWVSKDGIGAFGRL
LIGGRFGTLFDDDPKKWRMYADFIGSAGSIFELITPLYPGYFLPLASLGNLAKAVGRGFR
DPSFRVIQNHFAESGNLGEVAAKEEVWEVGAQLLGLSIGVFIMDTSGIKSSYPTLALTWL
GVRLLHLWFRYQSLSVLKFRTVR*

5'UTR

chr01:2245732..2245776 (+ strand) : 45 bp

CDS

chr01:2245777..2245916 (+ strand) : 140 bp

chr01:2246011..2246061 (+ strand) : 51 bp

chr01:2246174..2246322 (+ strand) : 149 bp

chr01:2246870..2246970 (+ strand) : 101 bp

chr01:2247327..2247385 (+ strand) : 59 bp

chr01:2247763..2247809 (+ strand) : 47 bp

chr01:2247952..2248030 (+ strand) : 79 bp

chr01:2248139..2248211 (+ strand) : 73 bp

chr01:2248324..2248413 (+ strand) : 90 bp

chr01:2248685..2248744 (+ strand) : 60 bp

chr01:2248881..2248999 (+ strand) : 119 bp

chr01:2249128..2249131 (+ strand) : 4 bp

3'UTR

chr01:2249132..2249188 (+ strand) : 57 bp

chr01:2249276..2249394 (+ strand) : 119 bp

chr01:2249921..2250016 (+ strand) : 96 bp

chr01:2250094..2250435 (+ strand) : 342 bp

FASTA

>Os01t0141600-01 class=Sequence position=chr01:2245732..2250435 (+ strand)
ACCCTTCCAC TTCCACTCGC TGGCGATAGC ACCGCACCGG AGCATATGCT CTCCGCAGCC GCCGCCGCCG CCGCCGACGC
GAGCTTCCAT GGCGGAGCTC CCCGACGAAG AAGACCGCGG CTACGCTCCT GCCTCGCGTC CCCGCCGGCA TCCGGTGGAG
GAGGAGGAGA CTGCCGCGAG TCCGAGTTCG TCACTGGATT TCGCGGCTCC GTTTCATGCC GCAGTTTTTT TTTTCTTCTT
CTTCTTGTTG ATAATGAAAT TTGTGCGCTT CTTATGCAGA AAAGCGAGAC GTTTGCTCGT GGAGAGATAC CAGGATGGGG
TTTCCAAGAG GTCTCTTCGC TTCTGAAATC CCAATTATAT TTCTCGCTGT CCATTTTCTT GAAATCCAAT AACACTTAGA
AAAGATGTGT GGAATTGCGG AATTGTGGTT AAAATTAAAT AGGTATATAC TGGATGGAAA CTCTAAGCTA CAGATTCACC
AGGAGAAGAA TGAACATATG GCGAACACAT TGGAAGAAGA AGAAAAAGAA GAAGCAAATT CTTCGATTCC CCGTGCTATT
AAGGATTTTG TACTTCCCGC GGGGTTTCCA GGTGACTTAA ACTGTTCCAT ATTTCGTACT CACTTTACCA TTCATCGCAG
ACTAGTATGA AGGGTCTCAG TTTGGTAAag gccgagttta gttccaaact tttttttcaa acttccaact ttttcatcac
atcaaaactt tcctacacac ataaacttcc aacttttccg tcacatcgtt ccaatttcaa ccaaacttcc aattttggtg
tgaactaaac acacccAAAG TACAAAAGTA GAAAGTTCAG TGAATAGGTG TTGTTCAAAC TTCCGTAATT AAGTCTAATG
AACAGTATCA CCATGCTGGG AGCCTGGGAC TACAGAATCT CACAACTCTT GTCGAACGTA GACCTGTATT Atgttgaata
atctcacatt ggctgtggaa gggtaaggga cctaatataa aaatggggga atcccttatc tcattggcta gcttgtgagg
gtgggaaagt tgctttatga tcctacaTTC CTACATAGGA GTATTATATA CTTCCTGGCA AACTCATAAC TCGCCGTTGT
TCTTTGTATA CATTACAGGG TCTGTGTCAG ACGATTACCT GGAATATATG CTATGGCAAT TACCAACAAA TGTAACAGGA
TGGATCTGTC ACACGCTGGT TACATCAACC CTTCTAAAGG TATATTATAA CTTGAACAAG TTAACAAAAG GTAGCTCCCT
TGTTTTATTT GGGAGTAGAT GACATGACCT TGTCACGTTC TCCCAAATAA AGAAGGGGAC AGGAAAAAAA ATGTCCTGCT
TTCGCGTGTT CTGTATTTCC AGTCGGCCTT TTTCTTTTGA TGATGATTAT GATCACTTTA CGATCTGACT TCTGAGGAGC
AAAATTACAA GAAAACATGT AGCCTGGTTT TAGTCTTATT GACATTATGT TATACAGTTG AGCAGTTCAA TTACAGTCTT
GAGTTTTTCA AAGCATGTTC TTCAATCATA ACGTTATGTC ACAATTTATG ATTAACTGAT TATAGATTGA CGCAGGCTGT
AGGTGTTGGG TCCTTTACAG GAACTTCAGC AGCTGCTTCT GCTGCTGCTA TAAGGTCATT ATCATCCTTG CTATGTTATA
TCGATTATTA GAAAAGAGTC CTTGGTATTA TTATTTCTCT CGAAGTGAAA GAATCATGAT ACTAATCTTC TTCTCTTTCA
TTTGTATTTT GGTTACCTTA ATTCTACTTG TATATATGAT AGGAAAGAGT TTTTCTTGAG TCTTGAATTA TTGCATGAAT
ATAGTTAGGG CATGTAGTCA AGCCTGAAGT GTGATGCCAA TGCAAGTAGA CCTGTTCATA TTGTGCTTGT AATTAACTCA
GGATGCCAAT GCAAGTAGAC ATGTTCATTT TGTGCTCGTA ATAACTCAGA CCTCCTAGTT TGTTGCTGAC TTAGATCCTC
CTAATTCTAA AAAAAAAAAC CATATTTGTA GATGGGTATC GAAAGATGGC ATAGGGGCTT TTGGACGTCT TCTAATTGGT
ACGGTTAATA TGTCTGGTCA TATTTTCAGA ATATAAATAC TGTCCAGGAA GGTGGGAAGG TTCATTAATA CTTTACATTG
TGCAGGAAGG TTTATGAATA ATCTATGTTG TTTAGGAAGC TTTGTGAATG ATTTCTTTAG GTGGACGATT CGGAACTCTT
TTTGATGATG ACCCAAAGAA GTGGCGGATG TATGCCGATT TCATTGGAAG TGCTGGAAGG TTCCTTGATC TACTCTCTTA
AATAATAAAA GCATATATGT AAGTTATGTT GACATGGTGA CTCGAAAATG CGAAAATTCA CTTGTAATAT TATCCGTACA
TATGCAGCAT CTTCGAGCTC ATCACTCCGC TCTATCCTGG ATACTTCCTC CCACTTGCGT CCTTGGGGAA TCTAGCAAAG
GTACATTGAA AAGAATATAT GTATCCGATG TAGTTTCACA GGTGACTTAA GTCTATCTTG AAAAGCCTGC ATTTTTGTAT
AGAAAATCAT TGATTCTGGA CTTCTTAAGC AGGCTGTAGG AAGAGGATTT AGGGATCCAT CCTTCCGTGT TATCCAAAAT
CACTTCGCGG AATCTGGAAA TTTAGGGGAG GTTGCTGCAA AGGTACCTTG TTCATTCCAG TACTTTCTAG CAGTCAATTC
AGTGTCACTG TGCCCTTTGA CTGCACAAGA TAGGTACACT GTCACAAATT ACCAGTTCTG GTTCAATCAA TATAATATTG
TTTTTATATG AAAAATAATG CAGTATTACA ATCATCGAAC AATTTTTCCA CGGAATATTA GTTTCAAATC ACATTGTTTT
GCTCCTGTGA ATAAGAGATC TATGATAATA ATTTCATTAA ATTTTCACTG AAGAAACTCT GATGTATTTT CAGGAGGAAG
TATGGGAAGT AGGAGCTCAG TTGTTAGGCC TTTCTATCGG TGTATTTATT ATGGTATAAT TATCCATAAG TTCTTGGGTT
GTTACTTGTT ACTTGTTTCA GTTTTTCAGT ATTCCATTAA CTATTGACTC TCCACTAAGG AAGACAAATG CCAACTTTGA
TTAAGAATCC ATTTGCTGGT ATATTTCAGG ATACATCAGG TATAAAGTCA TCATACCCAA CACTTGCTTT GACATGGCTT
GGTGTCCGTC TTCTACATCT TTGGTTTCGC TATCAGTCCC TATCAGTTCT CAAATTCCGC ACAGTAAGGT GCTTGGCTTA
AATTATGTTT TGCTCAATTT GGTACATTGA TTTTGGTAAC TCAATTTGTT AGATATGATA GTATACATAA ATATGATCTA
TCACCGTCAT TTCCCAATGC ATGTTTATAC TGGTAGGTAA ACTTGAAACG CGCTCGGATT CTCGTGAGAT CACACGTTGC
AAAGCACACA GTTCCTGGTG ACATATTCTT CACTTGATGC TTTTTGACAC TTTTCTTGCT TTCTGAAGCA ATCATTGATA
GCCATCCCTG TCCTTCTGTT GTAGATTATG TGACTTGCAA CGAGGAGGAG AATATTTTAA CATGGGAAAG ATTCTTGCAT
CCACAAATTT CTTTTGGTGT TCCCATGGAG AGAATGCTTG GTGAAGAGGA ATCCAGTGAC GTGGTATGAA TCTTCAGCAT
TTGTCCAAAT CCAAAGTTCT GCCAATTCCT TTTACTTTGC TATAATTTTT TTGAAACTTC ATATTACACT GCCTTTTGTA
ATCAAGATCC CTTGAGGCCT TGACAATTAG AGTTAAAAGC AATAACAAGA AAATCTCTCT GTTAAGCCGT AACTAGTGTT
TCAAAATTCA ATCAACAACT GCAGCCCGCC TTAGCCTTTT TTGTTGTTTT AGGTGAGTTT TTCTAAACCC AACAATGTTC
AAATATAGCC ACTATTTTTT AAAAATCTCC TGTATAGCGA GTTATGAACG CTTTCCCCAT TTAAGATAAC AATTAGGTGA
GTCAGCAGCT TAAGCCTGAC CCAGTATACA TCACCCGTTC TTTGTATCTG GTAGGCATTG ACGCATTGTC CTCACTGAAC
TGGTTGCTGC TGACCATGCA TGTTTTTAAC CTATTTATCA CTCATGACTC TGCAAGCATA TCTCACACCT TAATTCCAAC
CTATGACCAA TCTTTGAAAT TGATGATAGG TGGATAGACT ATTGAAGTTG TACAGAAATG AGAAATACAT CCTCTTTCTC
AATCCGATTG GAACAGGCCG AGCAGCATTT TTTGTTACAT TCAAGGTAAT TTACCACTTA AAATTGCTGC ACAGAAGATC
AGCAAGAAGT GCATAACATG TGTTTGTTCC TATTATTTCC AGGAGGCTGC AACGAGCATG TCAGTCCTCA GGAGCCTATG
GCAAGCGCAT TGGCTTGACA AAAATCAGCT AAGGCAGGAT GATGTTTTCT CTTGGCTAGA GGAGAGCGTT CTTGCGTTGG
AGCACGGATT CCCTGACTTC CTCAAACAGA TGGAAATAGC TGGCTGGGAT CAGAACCAGA TCATACTGAA GGTGCCAAAA
GAACCCATCA TGGTGATGGA ACACCCTGAC CAAGAGGTGT AAGATGACAA TGCCAACTAA CTAATCCATT Ctactccctc
cgtgtttttt aaatgtaaag gcgtattgac ttttggacat ggcgttagac cattcatctc atgc

Locus: Os01g0141600

Loading...

Locus: Os01g0141600

Loading...