Os01t0142800-01

Locus

Os01g0142800

Description

Putative peptide transporter, Long-distance translocation of dimethylarsinate to rice grain

RAP-DB Gene Symbol Synonym(s)

OsNPF8.1, OsPTR7, PTR7

RAP-DB Gene Name Synonym(s)

PROTEIN TRANSPORTER 7, peptide transporter 7

CGSNL Gene Symbol

PTR7

CGSNL Gene Name

PROTEIN TRANSPORTER 7

Oryzabase Gene Symbol Synonym(s)

OsPTR7, OsNPF8.1, NPF8.1

Oryzabase Gene Name Synonym(s)

NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER 8.1

Transcript Evidence

AK070036

AK105664

Protein Evidence

Q9FU86

Literature

PMID: 28340032

DOI: 10.1016/j.plantsci.2010.06.013

Note

Manual Curation

April 6, 2017

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Biological Process: oligopeptide transport (GO:0006857)

Molecular Function: transporter activity (GO:0005215)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Proton-dependent oligopeptide transporter family (IPR000109)

Major facilitator superfamily domain (IPR020846)

PTR2 family proton/oligopeptide symporter, conserved site (IPR018456)

Full-length cDNA

J023036E09 (Online Clone Ordering)

001-200-H07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0142800-01)

Others

Oryzabase (8915)

Transcript

2306 bp

>Os01t0142800-01 Putative peptide transporter, Long-distance translocation of dimethylarsinate to rice grain
GTTTTTTGACCAAAACTTTGCTGCTCACTGTCCTAGCTGGAGAGAATCCAGCGATACACG
CATGTCTTCTTCTTCAGCTCGGTCTTGGTTGCCGACCTCATTTGCAGATTTCTGCACATG
AGGCATCTCTCTCTCGAAGTATCGTGTTTTGATTTGGGCAGGTAGCCAGCCACTGTGAGA
GTGTGAGCTGAGGTGAGCATCGCCATGGGAGAGGTTGCAGAAGACATCTACACCCAAGAT
GGCACCGTGGACGTCAAGGGCAACCCGGCCACCAAGAAGAACACCGGCAACTGGCGTGCC
TGCCCCTACATCCTCGCTAACGAGTGCTGCGAGAGGCTGGCCTACTATGGCATGAGCACC
AACCTCGTGAACTACATGAAGACGCGGCTCGGGCAGGAGAGCGCCATTGCCGCCAACAAT
GTCACCAACTGGTCGGGGACTTGCTACATCACCCCCCTTCTCGGTGCCTTCTTGGCTGAT
GCCTACATGGGCAGGTTCTGGACCATTGCCAGCTTCATGATCATCTACATCCTGGGTTTG
GCGTTGCTGACAATGGCGTCGTCGGTGAAGGGGCTGGTGCCGGCGTGCGACGGAGGAGCG
TGTCACCCGACGGAGGCGCAGACGGGGGTGGTGTTCTTGGCGCTGTACCTGATAGCGCTG
GGCACCGGCGGGATCAAGCCGTGCGTGTCGTCGTTTGGCGCGGACCAGTTCGACGAGAAC
GACGAGGGGGAGAAGCGGAGCAAGAGCAGCTTCTTCAACTGGTTCTACTTCTCCATCAAC
ATCGGCGCGCTGGTGGCGTCGTCGGTGCTGGTGTACGTGCAGACGCACGTCGGGTGGGGG
TGGGGGTTCGGCATCCCGGCCGTCGTCATGGCCGTCGCCGTCGCCAGCTTCTTCGTCGGC
ACGCCGCTGTACAGGCACCAGCGGCCCGGGGGCAGCCCGCTGACGAGGATCGCGCAGGTG
CTCGTCGCGTCGGCGAGGAAGTGGGGCGTCGAGGTCCCCGCCGACGGGTCGCGGCTGCAC
GAGACGCTCGACAGGGAGTCCGGCATCGAGGGCAGCCGCAAGCTGGAGCACACCGGGCAG
TTCGCGTGCCTCGACAGGGCGGCGGTGGAGACGCCGGAGGACAGGTCGGCGGCGAACGCG
TCGGCGTGGCGGCTGTGCACGGTGACGCAGGTGGAGGAGCTGAAGAGCGTGGTGCGGCTG
CTGCCGATCTGGGCGAGCGGGATCGTGTTCGCGACGGTGTACGGGCAGATGAGCACCATG
TTCGTCCTCCAGGGGAACACGCTCGACGCCAGCATGGGGCCGCACTTCTCCATCCCGGCG
GCGTCGCTCTCCATCTTCGACACCCTCAGCGTCATCGTCTGGGTGCCGGTGTACGACCGC
CTCATCGTGCCGGCGGTGCGCGCCGTGACGGGGCGCCCACGCGGGTTCACCCAGCTGCAG
CGGATGGGCATCGGCctcgtcatctccgtcttctccatgctcgccgccggcgtgctcgac
gtcgtcaggctgcgcgccatcgctcgccacgggctctacggcgacaaggacgtcgtgccc
atctccatcttctggcaggtgccgcagtacttcatcatcggcgccgccgaGGTGTTCACG
TTCGTCGGGCAGCTGGAGTTCTTCTACGACCAGGCTCCCGACGCCATGCGCAGCATGTGC
TCGGCGCTGTCGCTCACCACCGTCGCGCTAGGCAACTACCTCAGCACGCTGCTCGTGACC
ATCGTTACCCATGTCACCACCCGGAACGGCGCCGTCGGGTGGATCCCGGACAACCTCAAC
CGCGGCCACCTCGACTACTTCTTCTGGctgctcgccgtgctcagcctcatcaacttcggc
gtctacctcgtcatcgccagctggtacacctacaagaagacggcggattcaccggacgac
aaggccgagcacgccggagcaaactgagccacgaggtgaagctgattatgacATACAAGG
GGGAATTGAACTGAATTGTGGCGTGTGAATGTCAGAATGTGTGGGGTTCTAAACAAGTTC
TTGGGAGATAAAATGGAAAGGAAATTAGTGTCGTTTGTGACCTTCAAATATGTTATAGTG
TTCATTGCATTATGTCTGGTAGGAAAAAATGAAGAAGAATAGGAGGATATAGTAGTTTAA
AAATATAAATGTGATGTTTAGTTTTCTAGAAATGCATTGGCCAAAGTTGTTCAAGAAATA
AGGTCTTCTGTGGTGGAGTATCTCATAAGTTCATTAGGTTGCAGAAATGCCATTGTTCAG
CAGTCAGAAAGACAGCGATTTATGGG

CDS

1743 bp

>Os01t0142800-01 Putative peptide transporter, Long-distance translocation of dimethylarsinate to rice grain
ATGGGAGAGGTTGCAGAAGACATCTACACCCAAGATGGCACCGTGGACGTCAAGGGCAAC
CCGGCCACCAAGAAGAACACCGGCAACTGGCGTGCCTGCCCCTACATCCTCGCTAACGAG
TGCTGCGAGAGGCTGGCCTACTATGGCATGAGCACCAACCTCGTGAACTACATGAAGACG
CGGCTCGGGCAGGAGAGCGCCATTGCCGCCAACAATGTCACCAACTGGTCGGGGACTTGC
TACATCACCCCCCTTCTCGGTGCCTTCTTGGCTGATGCCTACATGGGCAGGTTCTGGACC
ATTGCCAGCTTCATGATCATCTACATCCTGGGTTTGGCGTTGCTGACAATGGCGTCGTCG
GTGAAGGGGCTGGTGCCGGCGTGCGACGGAGGAGCGTGTCACCCGACGGAGGCGCAGACG
GGGGTGGTGTTCTTGGCGCTGTACCTGATAGCGCTGGGCACCGGCGGGATCAAGCCGTGC
GTGTCGTCGTTTGGCGCGGACCAGTTCGACGAGAACGACGAGGGGGAGAAGCGGAGCAAG
AGCAGCTTCTTCAACTGGTTCTACTTCTCCATCAACATCGGCGCGCTGGTGGCGTCGTCG
GTGCTGGTGTACGTGCAGACGCACGTCGGGTGGGGGTGGGGGTTCGGCATCCCGGCCGTC
GTCATGGCCGTCGCCGTCGCCAGCTTCTTCGTCGGCACGCCGCTGTACAGGCACCAGCGG
CCCGGGGGCAGCCCGCTGACGAGGATCGCGCAGGTGCTCGTCGCGTCGGCGAGGAAGTGG
GGCGTCGAGGTCCCCGCCGACGGGTCGCGGCTGCACGAGACGCTCGACAGGGAGTCCGGC
ATCGAGGGCAGCCGCAAGCTGGAGCACACCGGGCAGTTCGCGTGCCTCGACAGGGCGGCG
GTGGAGACGCCGGAGGACAGGTCGGCGGCGAACGCGTCGGCGTGGCGGCTGTGCACGGTG
ACGCAGGTGGAGGAGCTGAAGAGCGTGGTGCGGCTGCTGCCGATCTGGGCGAGCGGGATC
GTGTTCGCGACGGTGTACGGGCAGATGAGCACCATGTTCGTCCTCCAGGGGAACACGCTC
GACGCCAGCATGGGGCCGCACTTCTCCATCCCGGCGGCGTCGCTCTCCATCTTCGACACC
CTCAGCGTCATCGTCTGGGTGCCGGTGTACGACCGCCTCATCGTGCCGGCGGTGCGCGCC
GTGACGGGGCGCCCACGCGGGTTCACCCAGCTGCAGCGGATGGGCATCGGCctcgtcatc
tccgtcttctccatgctcgccgccggcgtgctcgacgtcgtcaggctgcgcgccatcgct
cgccacgggctctacggcgacaaggacgtcgtgcccatctccatcttctggcaggtgccg
cagtacttcatcatcggcgccgccgaGGTGTTCACGTTCGTCGGGCAGCTGGAGTTCTTC
TACGACCAGGCTCCCGACGCCATGCGCAGCATGTGCTCGGCGCTGTCGCTCACCACCGTC
GCGCTAGGCAACTACCTCAGCACGCTGCTCGTGACCATCGTTACCCATGTCACCACCCGG
AACGGCGCCGTCGGGTGGATCCCGGACAACCTCAACCGCGGCCACCTCGACTACTTCTTC
TGGctgctcgccgtgctcagcctcatcaacttcggcgtctacctcgtcatcgccagctgg
tacacctacaagaagacggcggattcaccggacgacaaggccgagcacgccggagcaaac
tga

Protein

581 aa

>Os01t0142800-01 Putative peptide transporter, Long-distance translocation of dimethylarsinate to rice grain
MGEVAEDIYTQDGTVDVKGNPATKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKT
RLGQESAIAANNVTNWSGTCYITPLLGAFLADAYMGRFWTIASFMIIYILGLALLTMASS
VKGLVPACDGGACHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSK
SSFFNWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVASFFVGTPLYRHQR
PGGSPLTRIAQVLVASARKWGVEVPADGSRLHETLDRESGIEGSRKLEHTGQFACLDRAA
VETPEDRSAANASAWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTL
DASMGPHFSIPAASLSIFDTLSVIVWVPVYDRLIVPAVRAVTGRPRGFTQLQRMGIGLVI
SVFSMLAAGVLDVVRLRAIARHGLYGDKDVVPISIFWQVPQYFIIGAAEVFTFVGQLEFF
YDQAPDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVTTRNGAVGWIPDNLNRGHLDYFF
WLLAVLSLINFGVYLVIASWYTYKKTADSPDDKAEHAGAN*

5'UTR

chr01:2294904..2295064 (+ strand) : 161 bp

chr01:2296000..2296042 (+ strand) : 43 bp

CDS

chr01:2296043..2296154 (+ strand) : 112 bp

chr01:2296258..2296475 (+ strand) : 218 bp

chr01:2296558..2297970 (+ strand) : 1413 bp

3'UTR

chr01:2297971..2298329 (+ strand) : 359 bp

FASTA

>Os01t0142800-01 class=Sequence position=chr01:2294904..2298329 (+ strand)
GTTTTTTGAC CAAAACTTTG CTGCTCACTG TCCTAGCTGG AGAGAATCCA GCGATACACG CATGTCTTCT TCTTCAGCTC
GGTCTTGGTT GCCGACCTCA TTTGCAGATT TCTGCACATG AGGCATCTCT CTCTCGAAGT ATCGTGTTTT GATTTGGGCA
GGTATGAGCA AAGGTCCCTC ATTTCTTCCT CTTTTCTAAA TCCTTGAGGA GAGCAGTGTG ATTTAAGGTT TCAGATGCCT
TGAATCCGCT GTGATTTGTC TGAATTTTTG TTAGTTAATT GATGCCCAAT TTGTTGGCTG AGATTGCCCC TGGACACCAA
CTAGGGAGCT ATTGCTTTAA TTGATGCCCA TTTGCTGGCT GAGGTTGCCT CTGAACACCA GCTGTTGCTT TAGTTTGTTA
GGGGAAATGT TGCTTTAGTG TCTGAAATGT TTAGTCTTGG CCTCTTGGGG TAAATTAATA TTTCAGCTTA AAATTAAGAT
TTCAGCTATT GCAATTTGCA AGGAGATATA TTCTTTGATA AATATATATC TTGGCATTTC TGCTAGATAA TGCTGACGCG
TGCCTCTTCT AAGAAACTTG CAGTGTTCTG CAAACTGAGA GTCTGAGATA AGCTGATAAC TCATCTAGTA ATTGTTGTTC
TGAAGCAAAG GGAAATACTT TCTTTACTGT TCATAAGCTC TCAGTAACTT AATCTGAGGA AGCAGGTTTA ACCAACCACT
GACATCTTAT TAATTGCTAG TGCTAGAGAT TTGCAAAGTT TCAGATAACA AAAGTGAGCA ATTGATACTA CCCTCCTCCA
CTAAAGCTAC TTTTTATACC AGTTTATTCT GTATCTAAAA TATCTGAACT TCAGTTGACT GGATTCGATT TAGTAACGAG
CTCAGGTAGC TTTCTGAACC AACCTAACTC CTGTATTTCT ACTCTGAATT TCTGATGGAT TACAACTATT CCTAATTATT
CATTGGTCGT AGTAGTCAGA TGGATTACAA CTATTCCTAA TTATTCATTG GTCGTAGTAG TCTTTCGTCA GAAGATATAT
ATCTGTACAT AACCCAATAT CTTCCTCATC AGAGACAGTC GTTGCAAACT TTGCAGGTAG CCAGCCACTG TGAGAGTGTG
AGCTGAGGTG AGCATCGCCA TGGGAGAGGT TGCAGAAGAC ATCTACACCC AAGATGGCAC CGTGGACGTC AAGGGCAACC
CGGCCACCAA GAAGAACACC GGCAACTGGC GTGCCTGCCC CTACATCCTC GGTAAGTAAC AACATCTTCC TCGTCGATTG
CCAAGCTTGT TCGTCTCCAT TGATGGTGAG ATATAAGCGA GTGAAGTGAC TGATGTTTGC AATGGTTTGA TCAGCTAACG
AGTGCTGCGA GAGGCTGGCC TACTATGGCA TGAGCACCAA CCTCGTGAAC TACATGAAGA CGCGGCTCGG GCAGGAGAGC
GCCATTGCCG CCAACAATGT CACCAACTGG TCGGGGACTT GCTACATCAC CCCCCTTCTC GGTGCCTTCT TGGCTGATGC
CTACATGGGC AGGTTCTGGA CCATTGCCAG CTTCATGATC ATCTACATCC TGGTAACTAA TCGTCTTGGA TTTCAGTTTC
TGATTGCTAT GATCGATGGT GTGATCGAAG AGAGAGATGT TTTGATGGTT GCAGGGTTTG GCGTTGCTGA CAATGGCGTC
GTCGGTGAAG GGGCTGGTGC CGGCGTGCGA CGGAGGAGCG TGTCACCCGA CGGAGGCGCA GACGGGGGTG GTGTTCTTGG
CGCTGTACCT GATAGCGCTG GGCACCGGCG GGATCAAGCC GTGCGTGTCG TCGTTTGGCG CGGACCAGTT CGACGAGAAC
GACGAGGGGG AGAAGCGGAG CAAGAGCAGC TTCTTCAACT GGTTCTACTT CTCCATCAAC ATCGGCGCGC TGGTGGCGTC
GTCGGTGCTG GTGTACGTGC AGACGCACGT CGGGTGGGGG TGGGGGTTCG GCATCCCGGC CGTCGTCATG GCCGTCGCCG
TCGCCAGCTT CTTCGTCGGC ACGCCGCTGT ACAGGCACCA GCGGCCCGGG GGCAGCCCGC TGACGAGGAT CGCGCAGGTG
CTCGTCGCGT CGGCGAGGAA GTGGGGCGTC GAGGTCCCCG CCGACGGGTC GCGGCTGCAC GAGACGCTCG ACAGGGAGTC
CGGCATCGAG GGCAGCCGCA AGCTGGAGCA CACCGGGCAG TTCGCGTGCC TCGACAGGGC GGCGGTGGAG ACGCCGGAGG
ACAGGTCGGC GGCGAACGCG TCGGCGTGGC GGCTGTGCAC GGTGACGCAG GTGGAGGAGC TGAAGAGCGT GGTGCGGCTG
CTGCCGATCT GGGCGAGCGG GATCGTGTTC GCGACGGTGT ACGGGCAGAT GAGCACCATG TTCGTCCTCC AGGGGAACAC
GCTCGACGCC AGCATGGGGC CGCACTTCTC CATCCCGGCG GCGTCGCTCT CCATCTTCGA CACCCTCAGC GTCATCGTCT
GGGTGCCGGT GTACGACCGC CTCATCGTGC CGGCGGTGCG CGCCGTGACG GGGCGCCCAC GCGGGTTCAC CCAGCTGCAG
CGGATGGGCA TCGGCctcgt catctccgtc ttctccatgc tcgccgccgg cgtgctcgac gtcgtcaggc tgcgcgccat
cgctcgccac gggctctacg gcgacaagga cgtcgtgccc atctccatct tctggcaggt gccgcagtac ttcatcatcg
gcgccgccga GGTGTTCACG TTCGTCGGGC AGCTGGAGTT CTTCTACGAC CAGGCTCCCG ACGCCATGCG CAGCATGTGC
TCGGCGCTGT CGCTCACCAC CGTCGCGCTA GGCAACTACC TCAGCACGCT GCTCGTGACC ATCGTTACCC ATGTCACCAC
CCGGAACGGC GCCGTCGGGT GGATCCCGGA CAACCTCAAC CGCGGCCACC TCGACTACTT CTTCTGGctg ctcgccgtgc
tcagcctcat caacttcggc gtctacctcg tcatcgccag ctggtacacc tacaagaaga cggcggattc accggacgac
aaggccgagc acgccggagc aaactgagcc acgaggtgaa gctgattatg acATACAAGG GGGAATTGAA CTGAATTGTG
GCGTGTGAAT GTCAGAATGT GTGGGGTTCT AAACAAGTTC TTGGGAGATA AAATGGAAAG GAAATTAGTG TCGTTTGTGA
CCTTCAAATA TGTTATAGTG TTCATTGCAT TATGTCTGGT AGGAAAAAAT GAAGAAGAAT AGGAGGATAT AGTAGTTTAA
AAATATAAAT GTGATGTTTA GTTTTCTAGA AATGCATTGG CCAAAGTTGT TCAAGAAATA AGGTCTTCTG TGGTGGAGTA
TCTCATAAGT TCATTAGGTT GCAGAAATGC CATTGTTCAG CAGTCAGAAA GACAGCGATT TATGGG

Locus: Os01g0142800

Loading...

Locus: Os01g0142800

Loading...