Os01t0142800-02

Locus

Os01g0142800

Description

Similar to cDNA clone:J023036E09, full insert sequence (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PTR7

CGSNL Gene Name

PROTEIN TRANSPORTER 7

Oryzabase Gene Symbol Synonym(s)

OsPTR7, OsNPF8.1, NPF8.1

Oryzabase Gene Name Synonym(s)

NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER 8.1

Transcript Evidence

AK102216 (DDBJ, Best hit)

Protein Evidence

B7EH87 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J033087L04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0142800-02)

Others

Oryzabase (8915)

Transcript

3089 bp

>Os01t0142800-02 Similar to cDNA clone:J023036E09, full insert sequence (Fragment).
GCAGATTTCTGCACATGAGGCATCTCTCTCTCGAAGTATCGTGTTTTGATTTGGGCAGGT
ATGAGCAAAGGTCCCTCATTTCTTCCTCTTTTCTAAATCCTTGAGGAGAGCAGTGTGATT
TAAGGTTTCAGATGCCTTGAATCCGCTGTGATTTGTCTGAATTTTTGTTAGTTAATTGAT
GCCCAATTTGTTGGCTGAGATTGCCCCTGGACACCAACTAGGGAGCTATTGCTTTAATTG
ATGCCCATTTGCTGGCTGAGGTTGCCTCTGAACACCAGCTGTTGCTTTAGTTTGTTAGGG
GAAATGTTGCTTTAGTGTCTGAAATGTTTAGTCTTGGCCTCTTGGGGTAAATTAATATTT
CAGCTTAAAATTAAGATTTCAGCTATTGCAATTTGCAAGGAGATATATTCTTTGATAAAT
ATATATCTTGGCATTTCTGCTAGATAATGCTGACGCGTGCCTCTTCTAAGAAACTTGCAG
TGTTCTGCAAACTGAGAGTCTGAGATAAGCTGATAACTCATCTAGTAATTGTTGTTCTGA
AGCAAAGGGAAATACTTTCTTTACTGTTCATAAGCTCTCAGTAACTTAATCTGAGGAAGC
AGGTTTAACCAACCACTGACATCTTATTAATTGCTAGTGCTAGAGATTTGCAAAGTTTCA
GATAACAAAAGTGAGCAATTGATACTACCCTCCTCCACTAAAGCTACTTTTTATACCAGT
TTATTCTGTATCTAAAATATCTGAACTTCAGTTGACTGGATTCGATTTAGTAACGAGCTC
AGGTAGCTTTCTGAACCAACCTAACTCCTGTATTTCTACTCTGAATTTCTGATGGATTAC
AACTATTCCTAATTATTCATTGGTCGTAGTAGTCAGATGGATTACAACTATTCCTAATTA
TTCATTGGTCGTAGTAGTCTTTCGTCAGAAGATATATATCTGTACATAACCCAATATCTT
CCTCATCAGAGACAGTCGTTGCAAACTTTGCAGGTAGCCAGCCACTGTGAGAGTGTGAGC
TGAGGTGAGCATCGCCATGGGAGAGGTTGCAGAAGACATCTACACCCAAGATGGCACCGT
GGACGTCAAGGGCAACCCGGCCACCAAGAAGAACACCGGCAACTGGCGTGCCTGCCCCTA
CATCCTCGGTAAGTAACAACATCTTCCTCGTCGATTGCCAAGCTTGTTCGTCTCCATTGA
TGGTGAGATATAAGCGAGTGAAGTGACTGATGTTTGCAATGGTTTGATCAGCTAACGAGT
GCTGCGAGAGGCTGGCCTACTATGGCATGAGCACCAACCTCGTGAACTACATGAAGACGC
GGCTCGGGCAGGAGAGCGCCATTGCCGCCAACAATGTCACCAACTGGTCGGGGACTTGCT
ACATCACCCCCCTTCTCGGTGCCTTCTTGGCTGATGCCTACATGGGCAGGTTCTGGACCA
TTGCCAGCTTCATGATCATCTACATCCTGGTAACTAATCGTCTTGGATTTCAGTTTCTGA
TTGCTATGATCGATGGTGTGATCGAAGAGAGAGATGTTTTGATGGTTGCAGGGTTTGGCG
TTGCTGACAATGGCGTCGTCGGTGAAGGGGCTGGTGCCGGCGTGCGACGGAGGAGCGTGT
CACCCGACGGAGGCGCAGACGGGGGTGGTGTTCTTGGCGCTGTACCTGATAGCGCTGGGC
ACCGGCGGGATCAAGCCGTGCGTGTCGTCGTTTGGCGCGGACCAGTTCGACGAGAACGAC
GAGGGGGAGAAGCGGAGCAAGAGCAGCTTCTTCAACTGGTTCTACTTCTCCATCAACATC
GGCGCGCTGGTGGCGTCGTCGGTGCTGGTGTACGTGCAGACGCACGTCGGGTGGGGGTGG
GGGTTCGGCATCCCGGCCGTCGTCATGGCCGTCGCCGTCGCCAGCTTCTTCGTCGGCACG
CCGCTGTACAGGCACCAGCGGCCCGGGGGCAGCCCGCTGACGAGGATCGCGCAGGTGCTC
GTCGCGTCGGCGAGGAAGTGGGGCGTCGAGGTCCCCGCCGACGGGTCGCGGCTGCACGAG
ACGCTCGACAGGGAGTCCGGCATCGAGGGCAGCCGCAAGCTGGAGCACACCGGGCAGTTC
GCGTGCCTCGACAGGGCGGCGGTGGAGACGCCGGAGGACAGGTCGGCGGCGAACGCGTCG
GCGTGGCGGCTGTGCACGGTGACGCAGGTGGAGGAGCTGAAGAGCGTGGTGCGGCTGCTG
CCGATCTGGGCGAGCGGGATCGTGTTCGCGACGGTGTACGGGCAGATGAGCACCATGTTC
GTCCTCCAGGGGAACACGCTCGACGCCAGCATGGGGCCGCACTTCTCCATCCCGGCGGCG
TCGCTCTCCATCTTCGACACCCTCAGCGTCATCGTCTGGGTGCCGGTGTACGACCGCCTC
ATCGTGCCGGCGGTGCGCGCCGTGACGGGGCGCCCACGCGGGTTCACCCAGCTGCAGCGG
ATGGGCATCGGCctcgtcatctccgtcttctccatgctcgccgccggcgtgctcgacgtc
gtcaggctgcgcgccatcgctcgccacgggctctacggcgacaaggacgtcgtgcccatc
tccatcttctggcaggtgccgcagtacttcatcatcggcgccgccgaGGTGTTCACGTTC
GTCGGGCAGCTGGAGTTCTTCTACGACCAGGCTCCCGACGCCATGCGCAGCATGTGCTCG
GCGCTGTCGCTCACCACCGTCGCGCTAGGCAACTACCTCAGCACGCTGCTCGTGACCATC
GTTACCCATGTCACCACCCGGAACGGCGCCGTCGGGTGGATCCCGGACAACCTCAACCGC
GGCCACCTCGACTACTTCTTCTGGctgctcgccgtgctcagcctcatcaacttcggcgtc
tacctcgtcatcgccagctggtacacctacaagaagacggcggattcaccggacgacaag
gccgagcacgccggagcaaactgagccacgaggtgaagctgattatgacATACAAGGGGG
AATTGAACTGAATTGTGGCGTGTGAATGTCAGAATGTGTGGGGTTCTAAACAAGTTCTTG
GGAGATAAAATGGAAAGGAAATTAGTGTC

CDS

1764 bp

>Os01t0142800-02 Similar to cDNA clone:J023036E09, full insert sequence (Fragment).
TCAGCTAACGAGTGCTGCGAGAGGCTGGCCTACTATGGCATGAGCACCAACCTCGTGAAC
TACATGAAGACGCGGCTCGGGCAGGAGAGCGCCATTGCCGCCAACAATGTCACCAACTGG
TCGGGGACTTGCTACATCACCCCCCTTCTCGGTGCCTTCTTGGCTGATGCCTACATGGGC
AGGTTCTGGACCATTGCCAGCTTCATGATCATCTACATCCTGGTAACTAATCGTCTTGGA
TTTCAGTTTCTGATTGCTATGATCGATGGTGTGATCGAAGAGAGAGATGTTTTGATGGTT
GCAGGGTTTGGCGTTGCTGACAATGGCGTCGTCGGTGAAGGGGCTGGTGCCGGCGTGCGA
CGGAGGAGCGTGTCACCCGACGGAGGCGCAGACGGGGGTGGTGTTCTTGGCGCTGTACCT
GATAGCGCTGGGCACCGGCGGGATCAAGCCGTGCGTGTCGTCGTTTGGCGCGGACCAGTT
CGACGAGAACGACGAGGGGGAGAAGCGGAGCAAGAGCAGCTTCTTCAACTGGTTCTACTT
CTCCATCAACATCGGCGCGCTGGTGGCGTCGTCGGTGCTGGTGTACGTGCAGACGCACGT
CGGGTGGGGGTGGGGGTTCGGCATCCCGGCCGTCGTCATGGCCGTCGCCGTCGCCAGCTT
CTTCGTCGGCACGCCGCTGTACAGGCACCAGCGGCCCGGGGGCAGCCCGCTGACGAGGAT
CGCGCAGGTGCTCGTCGCGTCGGCGAGGAAGTGGGGCGTCGAGGTCCCCGCCGACGGGTC
GCGGCTGCACGAGACGCTCGACAGGGAGTCCGGCATCGAGGGCAGCCGCAAGCTGGAGCA
CACCGGGCAGTTCGCGTGCCTCGACAGGGCGGCGGTGGAGACGCCGGAGGACAGGTCGGC
GGCGAACGCGTCGGCGTGGCGGCTGTGCACGGTGACGCAGGTGGAGGAGCTGAAGAGCGT
GGTGCGGCTGCTGCCGATCTGGGCGAGCGGGATCGTGTTCGCGACGGTGTACGGGCAGAT
GAGCACCATGTTCGTCCTCCAGGGGAACACGCTCGACGCCAGCATGGGGCCGCACTTCTC
CATCCCGGCGGCGTCGCTCTCCATCTTCGACACCCTCAGCGTCATCGTCTGGGTGCCGGT
GTACGACCGCCTCATCGTGCCGGCGGTGCGCGCCGTGACGGGGCGCCCACGCGGGTTCAC
CCAGCTGCAGCGGATGGGCATCGGCctcgtcatctccgtcttctccatgctcgccgccgg
cgtgctcgacgtcgtcaggctgcgcgccatcgctcgccacgggctctacggcgacaagga
cgtcgtgcccatctccatcttctggcaggtgccgcagtacttcatcatcggcgccgccga
GGTGTTCACGTTCGTCGGGCAGCTGGAGTTCTTCTACGACCAGGCTCCCGACGCCATGCG
CAGCATGTGCTCGGCGCTGTCGCTCACCACCGTCGCGCTAGGCAACTACCTCAGCACGCT
GCTCGTGACCATCGTTACCCATGTCACCACCCGGAACGGCGCCGTCGGGTGGATCCCGGA
CAACCTCAACCGCGGCCACCTCGACTACTTCTTCTGGctgctcgccgtgctcagcctcat
caacttcggcgtctacctcgtcatcgccagctggtacacctacaagaagacggcggattc
accggacgacaaggccgagcacgccggagcaaactgagccacgaggtgaagctgattatg
acATACAAGGGGGAATTGAACTGA

Protein

588 aa

>Os01t0142800-02 Similar to cDNA clone:J023036E09, full insert sequence (Fragment).
SANECCERLAYYGMSTNLVNYMKTRLGQESAIAANNVTNWSGTCYITPLLGAFLADAYMG
RFWTIASFMIIYILVTNRLGFQFLIAMIDGVIEERDVLMVAGFGVADNGVVGEGAGAGVR
RRSVSPDGGADGGGVLGAVPDSAGHRRDQAVRVVVWRGPVRRERRGGEAEQEQLLQLVLL
LHQHRRAGGVVGAGVRADARRVGVGVRHPGRRHGRRRRQLLRRHAAVQAPAARGQPADED
RAGARRVGEEVGRRGPRRRVAAARDARQGVRHRGQPQAGAHRAVRVPRQGGGGDAGGQVG
GERVGVAAVHGDAGGGAEERGAAAADLGERDRVRDGVRADEHHVRPPGEHARRQHGAALL
HPGGVALHLRHPQRHRLGAGVRPPHRAGGARRDGAPTRVHPAAADGHRPRHLRLLHARRR
RARRRQAARHRSPRALRRQGRRAHLHLLAGAAVLHHRRRRGVHVRRAAGVLLRPGSRRHA
QHVLGAVAHHRRARQLPQHAARDHRYPCHHPERRRRVDPGQPQPRPPRLLLLAARRAQPH
QLRRLPRHRQLVHLQEDGGFTGRQGRARRSKLSHEVKLIMTYKGELN*

5'UTR

chr01:2295007..2296253 (+ strand) : 1247 bp

CDS

chr01:2296254..2298017 (+ strand) : 1764 bp

3'UTR

chr01:2298018..2298095 (+ strand) : 78 bp

FASTA

>Os01t0142800-02 class=Sequence position=chr01:2295007..2298095 (+ strand)
GCAGATTTCT GCACATGAGG CATCTCTCTC TCGAAGTATC GTGTTTTGAT TTGGGCAGGT ATGAGCAAAG GTCCCTCATT
TCTTCCTCTT TTCTAAATCC TTGAGGAGAG CAGTGTGATT TAAGGTTTCA GATGCCTTGA ATCCGCTGTG ATTTGTCTGA
ATTTTTGTTA GTTAATTGAT GCCCAATTTG TTGGCTGAGA TTGCCCCTGG ACACCAACTA GGGAGCTATT GCTTTAATTG
ATGCCCATTT GCTGGCTGAG GTTGCCTCTG AACACCAGCT GTTGCTTTAG TTTGTTAGGG GAAATGTTGC TTTAGTGTCT
GAAATGTTTA GTCTTGGCCT CTTGGGGTAA ATTAATATTT CAGCTTAAAA TTAAGATTTC AGCTATTGCA ATTTGCAAGG
AGATATATTC TTTGATAAAT ATATATCTTG GCATTTCTGC TAGATAATGC TGACGCGTGC CTCTTCTAAG AAACTTGCAG
TGTTCTGCAA ACTGAGAGTC TGAGATAAGC TGATAACTCA TCTAGTAATT GTTGTTCTGA AGCAAAGGGA AATACTTTCT
TTACTGTTCA TAAGCTCTCA GTAACTTAAT CTGAGGAAGC AGGTTTAACC AACCACTGAC ATCTTATTAA TTGCTAGTGC
TAGAGATTTG CAAAGTTTCA GATAACAAAA GTGAGCAATT GATACTACCC TCCTCCACTA AAGCTACTTT TTATACCAGT
TTATTCTGTA TCTAAAATAT CTGAACTTCA GTTGACTGGA TTCGATTTAG TAACGAGCTC AGGTAGCTTT CTGAACCAAC
CTAACTCCTG TATTTCTACT CTGAATTTCT GATGGATTAC AACTATTCCT AATTATTCAT TGGTCGTAGT AGTCAGATGG
ATTACAACTA TTCCTAATTA TTCATTGGTC GTAGTAGTCT TTCGTCAGAA GATATATATC TGTACATAAC CCAATATCTT
CCTCATCAGA GACAGTCGTT GCAAACTTTG CAGGTAGCCA GCCACTGTGA GAGTGTGAGC TGAGGTGAGC ATCGCCATGG
GAGAGGTTGC AGAAGACATC TACACCCAAG ATGGCACCGT GGACGTCAAG GGCAACCCGG CCACCAAGAA GAACACCGGC
AACTGGCGTG CCTGCCCCTA CATCCTCGGT AAGTAACAAC ATCTTCCTCG TCGATTGCCA AGCTTGTTCG TCTCCATTGA
TGGTGAGATA TAAGCGAGTG AAGTGACTGA TGTTTGCAAT GGTTTGATCA GCTAACGAGT GCTGCGAGAG GCTGGCCTAC
TATGGCATGA GCACCAACCT CGTGAACTAC ATGAAGACGC GGCTCGGGCA GGAGAGCGCC ATTGCCGCCA ACAATGTCAC
CAACTGGTCG GGGACTTGCT ACATCACCCC CCTTCTCGGT GCCTTCTTGG CTGATGCCTA CATGGGCAGG TTCTGGACCA
TTGCCAGCTT CATGATCATC TACATCCTGG TAACTAATCG TCTTGGATTT CAGTTTCTGA TTGCTATGAT CGATGGTGTG
ATCGAAGAGA GAGATGTTTT GATGGTTGCA GGGTTTGGCG TTGCTGACAA TGGCGTCGTC GGTGAAGGGG CTGGTGCCGG
CGTGCGACGG AGGAGCGTGT CACCCGACGG AGGCGCAGAC GGGGGTGGTG TTCTTGGCGC TGTACCTGAT AGCGCTGGGC
ACCGGCGGGA TCAAGCCGTG CGTGTCGTCG TTTGGCGCGG ACCAGTTCGA CGAGAACGAC GAGGGGGAGA AGCGGAGCAA
GAGCAGCTTC TTCAACTGGT TCTACTTCTC CATCAACATC GGCGCGCTGG TGGCGTCGTC GGTGCTGGTG TACGTGCAGA
CGCACGTCGG GTGGGGGTGG GGGTTCGGCA TCCCGGCCGT CGTCATGGCC GTCGCCGTCG CCAGCTTCTT CGTCGGCACG
CCGCTGTACA GGCACCAGCG GCCCGGGGGC AGCCCGCTGA CGAGGATCGC GCAGGTGCTC GTCGCGTCGG CGAGGAAGTG
GGGCGTCGAG GTCCCCGCCG ACGGGTCGCG GCTGCACGAG ACGCTCGACA GGGAGTCCGG CATCGAGGGC AGCCGCAAGC
TGGAGCACAC CGGGCAGTTC GCGTGCCTCG ACAGGGCGGC GGTGGAGACG CCGGAGGACA GGTCGGCGGC GAACGCGTCG
GCGTGGCGGC TGTGCACGGT GACGCAGGTG GAGGAGCTGA AGAGCGTGGT GCGGCTGCTG CCGATCTGGG CGAGCGGGAT
CGTGTTCGCG ACGGTGTACG GGCAGATGAG CACCATGTTC GTCCTCCAGG GGAACACGCT CGACGCCAGC ATGGGGCCGC
ACTTCTCCAT CCCGGCGGCG TCGCTCTCCA TCTTCGACAC CCTCAGCGTC ATCGTCTGGG TGCCGGTGTA CGACCGCCTC
ATCGTGCCGG CGGTGCGCGC CGTGACGGGG CGCCCACGCG GGTTCACCCA GCTGCAGCGG ATGGGCATCG GCctcgtcat
ctccgtcttc tccatgctcg ccgccggcgt gctcgacgtc gtcaggctgc gcgccatcgc tcgccacggg ctctacggcg
acaaggacgt cgtgcccatc tccatcttct ggcaggtgcc gcagtacttc atcatcggcg ccgccgaGGT GTTCACGTTC
GTCGGGCAGC TGGAGTTCTT CTACGACCAG GCTCCCGACG CCATGCGCAG CATGTGCTCG GCGCTGTCGC TCACCACCGT
CGCGCTAGGC AACTACCTCA GCACGCTGCT CGTGACCATC GTTACCCATG TCACCACCCG GAACGGCGCC GTCGGGTGGA
TCCCGGACAA CCTCAACCGC GGCCACCTCG ACTACTTCTT CTGGctgctc gccgtgctca gcctcatcaa cttcggcgtc
tacctcgtca tcgccagctg gtacacctac aagaagacgg cggattcacc ggacgacaag gccgagcacg ccggagcaaa
ctgagccacg aggtgaagct gattatgacA TACAAGGGGG AATTGAACTG AATTGTGGCG TGTGAATGTC AGAATGTGTG
GGGTTCTAAA CAAGTTCTTG GGAGATAAAA TGGAAAGGAA ATTAGTGTC

Locus: Os01g0142800

Loading...

Locus: Os01g0142800

Loading...