Os01t0142800-03

Locus

Os01g0142800

Description

Similar to Peptide transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PTR7

CGSNL Gene Name

PROTEIN TRANSPORTER 7

Oryzabase Gene Symbol Synonym(s)

OsPTR7, OsNPF8.1, NPF8.1

Oryzabase Gene Name Synonym(s)

NITRATE TRANSPORTER 1/PEPTIDE TRANSPORTER 8.1

Transcript Evidence

AK058745 (DDBJ, Best hit)

Protein Evidence

B7EH87 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oligopeptide transport (GO:0006857)

Cellular Component: membrane (GO:0016020)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Oligopeptide transporter (IPR000109)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

PTR2 family proton/oligopeptide symporter, conserved site (IPR018456)

Full-length cDNA

001-019-H02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0142800-03)

RiceXPro (AK058745)

Others

Oryzabase (8915)

KEGG (Os01t0142800-03)

Transcript

1984 bp

>Os01t0142800-03 Similar to Peptide transporter.
ATATATCTGTACATAACCCAATATCTTCCTCATCAGAGACAGTCGTTGCAAACTTTGCAG
GTAGCCAGCCACTGTGAGAGTGTGAGCTGAGGTGAGCATCGCCATGGGAGAGGTTGCAGA
AGACATCTACACCCAAGATGGCACCGTGGACGTCAAGGGCAACCCGGCCACCAAGAAGAA
CACCGGCAACTGGCGTGCCTGCCCCTACATCCTCGCTAACGAGTGCTGCGAGAGGCTGGC
CTACTATGGCATGAGCACCAACCTCGTGAACTACATGAAGACGCGGCTCGGGCAGGAGAG
CGCCATTGCCGCCAACAATGTCACCAACTGGTCGGGGACTTGCTACATCACCCCCCTTCT
CGGTGCCTTCTTGGCTGATGCCTACATGGGCAGGTTCTGGACCATTGCCAGCTTCATGAT
CATCTACATCCTGGGTTTGGCGTTGCTGACAATGGCGTCGTCGGTGAAGGGGCTGGTGCC
GGCGTGCGACGGAGGAGCGTGTCACCCGACGGAGGCGCAGACGGGGGTGGTGTTCTTGGC
GCTGTACCTGATAGCGCTGGGCACCGGCGGGATCAAGCCGTGCGTGTCGTCGTTTGGCGC
GGACCAGTTCGACGAGAACGACGAGGGGGAGAAGCGGAGCAAGAGCAGCTTCTTCAACTG
GTTCTACTTCTCCATCAACATCGGCGCGCTGGTGGCGTCGTCGGTGCTGGTGTACGTGCA
GACGCACGTCGGGTGGGGGTGGGGGTTCGGCATCCCGGCCGTCGTCATGGCCGTCGCCGT
CGCCAGCTTCTTCGTCGGCACGCCGCTGTACAGGCACCAGCGGCCCGGGGGCAGCCCGCT
GACGAGGATCGCGCAGGTGCTCGTCGCGTCGGCGAGGAAGTGGGGCGTCGAGGTCCCCGC
CGACGGGTCGCGGCTGCACGAGACGCTCGACAGGGAGTCCGGCATCGAGGGCAGCCGCAA
GCTGGAGCACACCGGGCAGTTCGCGTGCCTCGACAGGGCGGCGGTGGAGACGCCGGAGGA
CAGGTCGGCGGCGAACGCGTCGGCGTGGCGGCTGTGCACGGTGACGCAGGTGGAGGAGCT
GAAGAGCGTGGTGCGGCTGCTGCCGATCTGGGCGAGCGGGATCGTGTTCGCGACGGTGTA
CGGGCAGATGAGCACCATGTTCGTCCTCCAGGGGAACACGCTCGACGCCAGCATGGGGCC
GCACTTCTCCATCCCGGCGGCGTCGCTCTCCATCTTCGACACCCTCAGCGTCATCGTCTG
GGTGCCGGTGTACGACCGCCTCATCGTGCCGGCGGTGCGCGCCGTGACGGGGCGCCCACG
CGGGTTCACCCAGCTGCAGCGGATGGGCATCGGCctcgtcatctccgtcttctccatgct
cgccgccggcgtgctcgacgtcgtcaggctgcgcgccatcgctcgccacgggctctacgg
cgacaaggacgtcgtgcccatctccatcttctggcaggtgccgcagtacttcatcatcgg
cgccgccgaGGTGTTCACGTTCGTCGGGCAGCTGGAGTTCTTCTACGACCAGGCTCCCGA
CGCCATGCGCAGCATGTGCTCGGCGCTGTCGCTCACCACCGTCGCGCTAGGCAACTACCT
CAGCACGCTGCTCGTGACCATCGTTACCCATGTCACCACCCGGAACGGCGCCGTCGGGTG
GATCCCGGACAACCTCAACCGCGGCCACCTCGACTACTTCTTCTGGctgctcgccgtgct
cagcctcatcaacttcggcgtctacctcgtcatcgccagctggtacacctacaagaagac
ggcggattcaccggacgacaaggccgagcacgccggagcaaactgagccacgaggtgaag
ctgattatgacATACAAGGGGGAATTGAACTGAATTGTGGCGTGTGAATGTCAGAATGTG
TGGGGTTCTAAACAAGTTCTTGGGAGATAAAATGGAAAGGAAATTAGTGTCGTTTGTGAC
CTTC

CDS

1743 bp

>Os01t0142800-03 Similar to Peptide transporter.
ATGGGAGAGGTTGCAGAAGACATCTACACCCAAGATGGCACCGTGGACGTCAAGGGCAAC
CCGGCCACCAAGAAGAACACCGGCAACTGGCGTGCCTGCCCCTACATCCTCGCTAACGAG
TGCTGCGAGAGGCTGGCCTACTATGGCATGAGCACCAACCTCGTGAACTACATGAAGACG
CGGCTCGGGCAGGAGAGCGCCATTGCCGCCAACAATGTCACCAACTGGTCGGGGACTTGC
TACATCACCCCCCTTCTCGGTGCCTTCTTGGCTGATGCCTACATGGGCAGGTTCTGGACC
ATTGCCAGCTTCATGATCATCTACATCCTGGGTTTGGCGTTGCTGACAATGGCGTCGTCG
GTGAAGGGGCTGGTGCCGGCGTGCGACGGAGGAGCGTGTCACCCGACGGAGGCGCAGACG
GGGGTGGTGTTCTTGGCGCTGTACCTGATAGCGCTGGGCACCGGCGGGATCAAGCCGTGC
GTGTCGTCGTTTGGCGCGGACCAGTTCGACGAGAACGACGAGGGGGAGAAGCGGAGCAAG
AGCAGCTTCTTCAACTGGTTCTACTTCTCCATCAACATCGGCGCGCTGGTGGCGTCGTCG
GTGCTGGTGTACGTGCAGACGCACGTCGGGTGGGGGTGGGGGTTCGGCATCCCGGCCGTC
GTCATGGCCGTCGCCGTCGCCAGCTTCTTCGTCGGCACGCCGCTGTACAGGCACCAGCGG
CCCGGGGGCAGCCCGCTGACGAGGATCGCGCAGGTGCTCGTCGCGTCGGCGAGGAAGTGG
GGCGTCGAGGTCCCCGCCGACGGGTCGCGGCTGCACGAGACGCTCGACAGGGAGTCCGGC
ATCGAGGGCAGCCGCAAGCTGGAGCACACCGGGCAGTTCGCGTGCCTCGACAGGGCGGCG
GTGGAGACGCCGGAGGACAGGTCGGCGGCGAACGCGTCGGCGTGGCGGCTGTGCACGGTG
ACGCAGGTGGAGGAGCTGAAGAGCGTGGTGCGGCTGCTGCCGATCTGGGCGAGCGGGATC
GTGTTCGCGACGGTGTACGGGCAGATGAGCACCATGTTCGTCCTCCAGGGGAACACGCTC
GACGCCAGCATGGGGCCGCACTTCTCCATCCCGGCGGCGTCGCTCTCCATCTTCGACACC
CTCAGCGTCATCGTCTGGGTGCCGGTGTACGACCGCCTCATCGTGCCGGCGGTGCGCGCC
GTGACGGGGCGCCCACGCGGGTTCACCCAGCTGCAGCGGATGGGCATCGGCctcgtcatc
tccgtcttctccatgctcgccgccggcgtgctcgacgtcgtcaggctgcgcgccatcgct
cgccacgggctctacggcgacaaggacgtcgtgcccatctccatcttctggcaggtgccg
cagtacttcatcatcggcgccgccgaGGTGTTCACGTTCGTCGGGCAGCTGGAGTTCTTC
TACGACCAGGCTCCCGACGCCATGCGCAGCATGTGCTCGGCGCTGTCGCTCACCACCGTC
GCGCTAGGCAACTACCTCAGCACGCTGCTCGTGACCATCGTTACCCATGTCACCACCCGG
AACGGCGCCGTCGGGTGGATCCCGGACAACCTCAACCGCGGCCACCTCGACTACTTCTTC
TGGctgctcgccgtgctcagcctcatcaacttcggcgtctacctcgtcatcgccagctgg
tacacctacaagaagacggcggattcaccggacgacaaggccgagcacgccggagcaaac
tga

Protein

581 aa

>Os01t0142800-03 Similar to Peptide transporter.
MGEVAEDIYTQDGTVDVKGNPATKKNTGNWRACPYILANECCERLAYYGMSTNLVNYMKT
RLGQESAIAANNVTNWSGTCYITPLLGAFLADAYMGRFWTIASFMIIYILGLALLTMASS
VKGLVPACDGGACHPTEAQTGVVFLALYLIALGTGGIKPCVSSFGADQFDENDEGEKRSK
SSFFNWFYFSINIGALVASSVLVYVQTHVGWGWGFGIPAVVMAVAVASFFVGTPLYRHQR
PGGSPLTRIAQVLVASARKWGVEVPADGSRLHETLDRESGIEGSRKLEHTGQFACLDRAA
VETPEDRSAANASAWRLCTVTQVEELKSVVRLLPIWASGIVFATVYGQMSTMFVLQGNTL
DASMGPHFSIPAASLSIFDTLSVIVWVPVYDRLIVPAVRAVTGRPRGFTQLQRMGIGLVI
SVFSMLAAGVLDVVRLRAIARHGLYGDKDVVPISIFWQVPQYFIIGAAEVFTFVGQLEFF
YDQAPDAMRSMCSALSLTTVALGNYLSTLLVTIVTHVTTRNGAVGWIPDNLNRGHLDYFF
WLLAVLSLINFGVYLVIASWYTYKKTADSPDDKAEHAGAN*

5'UTR

chr01:2295940..2296042 (+ strand) : 103 bp

CDS

chr01:2296043..2296154 (+ strand) : 112 bp

chr01:2296258..2296475 (+ strand) : 218 bp

chr01:2296558..2297970 (+ strand) : 1413 bp

3'UTR

chr01:2297971..2298108 (+ strand) : 138 bp

FASTA

>Os01t0142800-03 class=Sequence position=chr01:2295940..2298108 (+ strand)
ATATATCTGT ACATAACCCA ATATCTTCCT CATCAGAGAC AGTCGTTGCA AACTTTGCAG GTAGCCAGCC ACTGTGAGAG
TGTGAGCTGA GGTGAGCATC GCCATGGGAG AGGTTGCAGA AGACATCTAC ACCCAAGATG GCACCGTGGA CGTCAAGGGC
AACCCGGCCA CCAAGAAGAA CACCGGCAAC TGGCGTGCCT GCCCCTACAT CCTCGGTAAG TAACAACATC TTCCTCGTCG
ATTGCCAAGC TTGTTCGTCT CCATTGATGG TGAGATATAA GCGAGTGAAG TGACTGATGT TTGCAATGGT TTGATCAGCT
AACGAGTGCT GCGAGAGGCT GGCCTACTAT GGCATGAGCA CCAACCTCGT GAACTACATG AAGACGCGGC TCGGGCAGGA
GAGCGCCATT GCCGCCAACA ATGTCACCAA CTGGTCGGGG ACTTGCTACA TCACCCCCCT TCTCGGTGCC TTCTTGGCTG
ATGCCTACAT GGGCAGGTTC TGGACCATTG CCAGCTTCAT GATCATCTAC ATCCTGGTAA CTAATCGTCT TGGATTTCAG
TTTCTGATTG CTATGATCGA TGGTGTGATC GAAGAGAGAG ATGTTTTGAT GGTTGCAGGG TTTGGCGTTG CTGACAATGG
CGTCGTCGGT GAAGGGGCTG GTGCCGGCGT GCGACGGAGG AGCGTGTCAC CCGACGGAGG CGCAGACGGG GGTGGTGTTC
TTGGCGCTGT ACCTGATAGC GCTGGGCACC GGCGGGATCA AGCCGTGCGT GTCGTCGTTT GGCGCGGACC AGTTCGACGA
GAACGACGAG GGGGAGAAGC GGAGCAAGAG CAGCTTCTTC AACTGGTTCT ACTTCTCCAT CAACATCGGC GCGCTGGTGG
CGTCGTCGGT GCTGGTGTAC GTGCAGACGC ACGTCGGGTG GGGGTGGGGG TTCGGCATCC CGGCCGTCGT CATGGCCGTC
GCCGTCGCCA GCTTCTTCGT CGGCACGCCG CTGTACAGGC ACCAGCGGCC CGGGGGCAGC CCGCTGACGA GGATCGCGCA
GGTGCTCGTC GCGTCGGCGA GGAAGTGGGG CGTCGAGGTC CCCGCCGACG GGTCGCGGCT GCACGAGACG CTCGACAGGG
AGTCCGGCAT CGAGGGCAGC CGCAAGCTGG AGCACACCGG GCAGTTCGCG TGCCTCGACA GGGCGGCGGT GGAGACGCCG
GAGGACAGGT CGGCGGCGAA CGCGTCGGCG TGGCGGCTGT GCACGGTGAC GCAGGTGGAG GAGCTGAAGA GCGTGGTGCG
GCTGCTGCCG ATCTGGGCGA GCGGGATCGT GTTCGCGACG GTGTACGGGC AGATGAGCAC CATGTTCGTC CTCCAGGGGA
ACACGCTCGA CGCCAGCATG GGGCCGCACT TCTCCATCCC GGCGGCGTCG CTCTCCATCT TCGACACCCT CAGCGTCATC
GTCTGGGTGC CGGTGTACGA CCGCCTCATC GTGCCGGCGG TGCGCGCCGT GACGGGGCGC CCACGCGGGT TCACCCAGCT
GCAGCGGATG GGCATCGGCc tcgtcatctc cgtcttctcc atgctcgccg ccggcgtgct cgacgtcgtc aggctgcgcg
ccatcgctcg ccacgggctc tacggcgaca aggacgtcgt gcccatctcc atcttctggc aggtgccgca gtacttcatc
atcggcgccg ccgaGGTGTT CACGTTCGTC GGGCAGCTGG AGTTCTTCTA CGACCAGGCT CCCGACGCCA TGCGCAGCAT
GTGCTCGGCG CTGTCGCTCA CCACCGTCGC GCTAGGCAAC TACCTCAGCA CGCTGCTCGT GACCATCGTT ACCCATGTCA
CCACCCGGAA CGGCGCCGTC GGGTGGATCC CGGACAACCT CAACCGCGGC CACCTCGACT ACTTCTTCTG Gctgctcgcc
gtgctcagcc tcatcaactt cggcgtctac ctcgtcatcg ccagctggta cacctacaag aagacggcgg attcaccgga
cgacaaggcc gagcacgccg gagcaaactg agccacgagg tgaagctgat tatgacATAC AAGGGGGAAT TGAACTGAAT
TGTGGCGTGT GAATGTCAGA ATGTGTGGGG TTCTAAACAA GTTCTTGGGA GATAAAATGG AAAGGAAATT AGTGTCGTTT
GTGACCTTC

Locus: Os01g0142800

Loading...

Locus: Os01g0142800

Loading...