Os01t0149500-01

Locus

Os01g0149500

Description

NBS-LRR domain-containing protein, Rice blast disease resistance

RAP-DB Gene Symbol Synonym(s)

PIT, Pit, Pit(K59), Pit(Npb), Pi-t, PitNpb, PitK59

RAP-DB Gene Name Synonym(s)

PYRICULARIA ORYZAE RESISTANCE T, Pyricularia oryzae resistance-t, Magnaporthe grisea resistance-t, Blast resistance 5

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AB379817

KF741801

AK100477 (partial)

AB379815 (K59)

Protein Evidence

A2ZP99

Literature

PMID: 18808453

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

January 8, 2016

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

NB-ARC (IPR002182)

Leucine-rich repeat domain, L domain-like (IPR032675)

Expression Databases

TENOR (Os01t0149500-01)

Transcript

4937 bp

>Os01t0149500-01 NBS-LRR domain-containing protein, Rice blast disease resistance
GTGCGGTGGGGGGCATTTCATCGAACACCATTCGCGCATCGCTCTCCCCGAGCGAACCGC
ATTCGTTACGTTACGTTACGTGCGAGATGAATCAACTTGTCAGGTACAAACACAACCGGA
GAATTTGCTTTTGTTTATACTGGAGTTATACGATGTGATCCTGATCCAGGCTCAGTTCGA
CCTAGCCCCTGCTTATCTTTGCTTGTGGGTCGTTGTCGCCGTCTTTGGTTACGCTAGGAG
AAGCATCTCTCTTTCTTGCGTAGGTAATCAACTATCTTAATTTTTCTTTTGTGTCTTGAT
TATGTGCAACACCGAGTGATGCGAATGGGATGTGTTCCTTTCGATGTTTTTTCTATATAA
GCTCTGAAACTTGGACTTTTGCAACAAATGGTTCGGGTGCAGATGAGCTGTTTGACGAAA
TGCCCAGGAGATTCCTGCGTGCGTTGCATGCCCAGCGGCGGTTTGACTCTATTTTTCCTT
TAGTATGGTGTCTGCTCTCTGGTGATCTAATGTACCATTTTCTCTTAACCTTGTTTTACC
CAATCTTAATGCAAAGATGCATAAAGAGAACTCTGCATATTCCTGTTTTCTCTTAACCTT
GTTTCAGAGAACCTTGTTTTCTCTGAACTCTGCAAAAGATTTTCTGCATATTCCTGAAAA
AAGGAGAACTCTGCTCCGGTGCTTTTAACTAGACTTATAAAGGCTTTGGCATAGGATTCC
TGTATTGGTTGATGCAAAATCTGCTGGTAACAGTCAGCTAAATTCGCTTAAAAAGTACAC
TTCTTTGGGTCTTCTTGCTAGTGCAGGTAGAGAAGCACCATGGCCTTCCTGGTTTCTTAG
GTGGTAAACAGGCAAAGAAAGTAAAGCACCAAGTGGCGCCATTGCTGCAATGAAATCAAA
TTATTATTAGCAAGTGGATGAAAGGAAAAGAATACACAGCCTGGAAGAGCTTTCAACTTG
AATCCCCTTGCAATTGTGTAACACTACTTGTCCTTTTCACATTGCATCATCGTTGAAACA
TTTGGATTTTAATACAAAAATCATTGTGGGTAGATTTTGCCTCAAAAAGTGCTTTCATAC
TGTTTTAATTTTGTCAGGTTTTTCAGACGTTTTGCAATAGAGAATGTCAATGTCCATTGT
GACAAAGGCAGTTGGTGGCAAGAAAGGGAGGAGAATCTATAACAGCTCTCTTCTGCAATC
TGCATTGCCCTCTCTGTTCTCATCAGGTTTTAGCCACACTGCTTCAATATCTCTTTCCAT
CTTCCGTATTTAAGTGATCGGCACTCAGCAGCTCTGTGAGATATCTCTTCTGGGATCTGC
AGTTTCAAGCATCTCCCATAGGAGAGATCCAGTGGGAATCCGTAGGTTCTAGCACTATGG
GCACAGTTTTGGATGCTCTCGCTTGGAAATTCTTGGAAAAGCTGGGTCAACTTATTGAGG
ATGAGGTTATCATGACATTAAGTGTGAAAAGGGGTATTGAGAGCCTGAAGAAAAATCTGG
AATTCTTCAACGCTGTTCATGAGGATGCTGAGGCTCTGGCCATGGAGGATCCAGGGATAG
ATTCATGGTGGAAGAACATGAGAGATGTTATGTTTGATGTCGATGACATCGTAGATCTTT
TCATGGTTCATTCACAGAAGCTCTTGCTGCCACCAAGGCCGGTATGTTGCAATCAGCCCT
TGTTCTCTAGCTTTGCAAAGTTTTCATTTGATCACATGATTGCCAAAAGAATTGATAATA
TAAATGAAAAGTTTGAAGAAATTAAAATGAACAAAGAGATGTTTGGCTTGGAGAGAACCA
ACGGGCAACAAATCCAGATAACAATTGTTGACAGAAGTCAGACATCTCCTGTAGATGAAC
TTGAGGTGGTTGGAGAAGATATCAGAAGGGCTATTGATGACATCGTCAAAATGATTGTTA
GTAGTAACTACAATGAAAGCAGGTCAACTGTTTTTGGGATCCAGGGGATGGGAGGCATCG
GTAAGACAACATTAGCTCAAAAGATATACAATGAACAGAGGATAAGGGAGAAATTCCAAG
TTCATATATGGTTGTGCATTTCTCAGAATTACACAGAGACCAGTTTGTTAAAACAGGCAA
TCAGAATGGCTGGAGGAATTTGTGATCAGCTGGAGACTAAGACTGAGCTTCTACCGCTTC
TAGTGGACACTATTAGAGGGAAGAGTGTTTTTCTTGTGCTGGATGATGTTTGGAAATCTG
ATGTATGGATTGATCTTCTTCGTTTGCCTTTCTTGAGAGGTTTGAATTCTCATATCCTTG
TGACCTCAAGAAACCTGGATGTTTTGGTTGAAATGCATGCAACTTATACCCACAAGGTAA
ACAAAATGAATGATTGCGATGGCCTAGAACTGCTGATGAAGATGTCATTAGGGCCATACG
AGCAAAGCAGAGAATTCAGTGGTGTTGGATATCAAATTGTCAAAAAGTGTGATGGCCTTC
CTCTTGCCATCAAAGTTGTTGCAGGTGTTCTATCTACTAAAAGAACAAGGGCAGAATGGG
AGAGTATCCGAGATAGCAAGTGGTCCATTCATGGACTTCCCAGAGAACTAGGAGGCCCTC
TGTACTTAAGCTACAGCAACTTACCCCCTGAACTTAAACAATGCTTTCTCTGGTGTGCTT
TGTTGCCGTCAAATTTTGTGATACGTCGTGATGCTGTCGCTTACTGGTGGGTTGCTGAAG
GTTTCGTGACGGAAGTGCATGGGTACTCAATACATGAGGTTGCTGAAGAGTACTACCATG
AGCTAATCAGAAGGAATCTTCTGCAGCCACGACCAGAGTTTGTAGACAAAGGCGAGTCAA
CAATGCATGATCTATTGAGGTCACTTGGTCAATTTTTGACAAAGGATCACTCCATATTCA
TGAACATGGAATATAGCAAAGCCTTACCAAATCTACGCCACTTATGTATCAGCAATGATG
TAGAAGAAATACCTGCTATAGAAAAGCAAAAGTGCTTGAGGAGCCTCCTAGTTTTTGATA
ACAAAAACTTCATGAAAATTAATAAGGACATTTTCAGAGAACTCAAGCATATCCGTGTCT
TAGTTCTCAGTGGAACAAGCATCCAAATCATACCAGAGTCAGTGGGAAACTTCTTGTTAC
TGAGGCTTCTAGATCTAAGCTATACAAAAATTCAGAAACTCCCAGAATCCATAGGAAAAC
TTACCAGCCTTGAATACCTTTCTTTGCATGGTTGCATACATTTGGATAGCCTGCCAGATA
GTTTAATGAGACTGTCGAACATAAGTTTCCTAGAGCTAGAACAGACTGCAATCGACCATG
TTCCAAAAGGAGTTGCAAAGTTGCAGCAACTCTACAACCTTAGAGGAGTTTTTGACAGTG
GAACTGGATTCAGACTAGATGAACTCCAATGTCTCTCCAATATCCAACGTCTCCGGATTG
TGAAGCTAGAAAAAGCAGCACCAGGGGGTTCATTTGTACTCAAGAACTGTCTTCATCTTC
GAGAATTGTGGCTCGGTTGCACAATCGGAGGTCATGATAAAACTTATTATCAGACCAACG
AGATTGAGAGAATTCAGCAAGTCTACGAACTGCTAATTCCATCGCCAAGCTTACTGTATA
TATTTCTTGTCGGGTTCCCTGGTGTAAGGTTCCCAGATTGGTTGTGCTCAGAACCAGAGC
GTAAGATGCCAAATTTGGGTCATATGCACCTCAACGACTGCACTTCATGTTCAGTGCTTC
CACCAGCAGGCCAGATGCCAGAACTGCTAGTTTTTAAGATTAAAGGCGCAGATGCAATAG
TGAATATGGGTGCAGAGCTGCTAGGGAAAGGCGTCAATAGCGCAAAGCATATAACTATTT
TTCCAAAACTCGAATTGCTTCTCATCACTAACATGAGCAATTTGGAAAGTTGGTCTCTCA
ACACATGGAATTTGTGTGGCAAATCTGAACAGCTTGTTCTGATGCCTTGCCTTAAGCGTT
TGTTTCTTAACGACTGCCCAAAACTAAGGGCTCTCCCTGAAGACTTGCATAGGATTGCTA
ACTTAAGAAGAATCCATATCGAAGGTGCTCACACGCTGCAAGAAGTTGACAACCTTCCTT
CAGTGTTATGGCTCAAGGTCAAGAACAACAGGTGTTTGAGGAGAATTTCCAATCTCTGTA
ATCTAAAGGACTTGCTTGCGCAGGACTGTCCAGCGCTGTATCAGGCAGAGAATCTAATCT
CACTAAAGAGACTCTACATGGTCGATTGCCACAACGCGAAGCAATTCAGGATGAGCCTCC
TGGAAGACCAACAACTTGCCGTCCATGTTGTTACAGTTGGTGCAGATGGCAGGGATATCT
TTCCAGATGAATCTCTCTATAATTAGTACTAGAGTGGAGCGCACTTAAGGAAATGGTGAT
ACTAGTGCACCTGAAATGTTACAGGAAAACAATTCAATTTCTGTGGTAAGTGGTAGCCAA
TGGTATTCAAAATGCAGTCCAGTGGTAAATGCAGCTTGGTGCAGTCCTAACAGAAGGAAG
CAACATCGTTTACCGAGATTATAGCTTGAATTCATCAGCTTAATATAAATGCAAAAATTT
GGAAACTTGGTCAGCACTGTCGAAAACTAGATATCCCTTCAGGTGAAGTTGCCTGACTCA
AGGTTAAGACTAACATCAATTTGCCACTGCTGGAGGTAAGAACGGTGGGTGTAAATGCTG
CCTCGATTGCAGCATAGTGTGATGCTATCTCCAAGACTGATTCAGGCTGAGCAGCCTCTG
AGAGCTTGTGCAGATTTCAAATCCAACGAGTTTTTGAACATGTTCTTGTCCGTTGGGCTC
CTCCATGTAAATATCTTGAACAGCATGACCAATAGACGTTCCCAGTACTCAATACAAATA
CTTTTCAGGACTTCAGATCGATCAACATGTTAAACTTGGAATATGCAAGAACTGGGTGTG
ATAAACAACGATCGAAG

CDS

2970 bp

>Os01t0149500-01 NBS-LRR domain-containing protein, Rice blast disease resistance
ATGGGCACAGTTTTGGATGCTCTCGCTTGGAAATTCTTGGAAAAGCTGGGTCAACTTATT
GAGGATGAGGTTATCATGACATTAAGTGTGAAAAGGGGTATTGAGAGCCTGAAGAAAAAT
CTGGAATTCTTCAACGCTGTTCATGAGGATGCTGAGGCTCTGGCCATGGAGGATCCAGGG
ATAGATTCATGGTGGAAGAACATGAGAGATGTTATGTTTGATGTCGATGACATCGTAGAT
CTTTTCATGGTTCATTCACAGAAGCTCTTGCTGCCACCAAGGCCGGTATGTTGCAATCAG
CCCTTGTTCTCTAGCTTTGCAAAGTTTTCATTTGATCACATGATTGCCAAAAGAATTGAT
AATATAAATGAAAAGTTTGAAGAAATTAAAATGAACAAAGAGATGTTTGGCTTGGAGAGA
ACCAACGGGCAACAAATCCAGATAACAATTGTTGACAGAAGTCAGACATCTCCTGTAGAT
GAACTTGAGGTGGTTGGAGAAGATATCAGAAGGGCTATTGATGACATCGTCAAAATGATT
GTTAGTAGTAACTACAATGAAAGCAGGTCAACTGTTTTTGGGATCCAGGGGATGGGAGGC
ATCGGTAAGACAACATTAGCTCAAAAGATATACAATGAACAGAGGATAAGGGAGAAATTC
CAAGTTCATATATGGTTGTGCATTTCTCAGAATTACACAGAGACCAGTTTGTTAAAACAG
GCAATCAGAATGGCTGGAGGAATTTGTGATCAGCTGGAGACTAAGACTGAGCTTCTACCG
CTTCTAGTGGACACTATTAGAGGGAAGAGTGTTTTTCTTGTGCTGGATGATGTTTGGAAA
TCTGATGTATGGATTGATCTTCTTCGTTTGCCTTTCTTGAGAGGTTTGAATTCTCATATC
CTTGTGACCTCAAGAAACCTGGATGTTTTGGTTGAAATGCATGCAACTTATACCCACAAG
GTAAACAAAATGAATGATTGCGATGGCCTAGAACTGCTGATGAAGATGTCATTAGGGCCA
TACGAGCAAAGCAGAGAATTCAGTGGTGTTGGATATCAAATTGTCAAAAAGTGTGATGGC
CTTCCTCTTGCCATCAAAGTTGTTGCAGGTGTTCTATCTACTAAAAGAACAAGGGCAGAA
TGGGAGAGTATCCGAGATAGCAAGTGGTCCATTCATGGACTTCCCAGAGAACTAGGAGGC
CCTCTGTACTTAAGCTACAGCAACTTACCCCCTGAACTTAAACAATGCTTTCTCTGGTGT
GCTTTGTTGCCGTCAAATTTTGTGATACGTCGTGATGCTGTCGCTTACTGGTGGGTTGCT
GAAGGTTTCGTGACGGAAGTGCATGGGTACTCAATACATGAGGTTGCTGAAGAGTACTAC
CATGAGCTAATCAGAAGGAATCTTCTGCAGCCACGACCAGAGTTTGTAGACAAAGGCGAG
TCAACAATGCATGATCTATTGAGGTCACTTGGTCAATTTTTGACAAAGGATCACTCCATA
TTCATGAACATGGAATATAGCAAAGCCTTACCAAATCTACGCCACTTATGTATCAGCAAT
GATGTAGAAGAAATACCTGCTATAGAAAAGCAAAAGTGCTTGAGGAGCCTCCTAGTTTTT
GATAACAAAAACTTCATGAAAATTAATAAGGACATTTTCAGAGAACTCAAGCATATCCGT
GTCTTAGTTCTCAGTGGAACAAGCATCCAAATCATACCAGAGTCAGTGGGAAACTTCTTG
TTACTGAGGCTTCTAGATCTAAGCTATACAAAAATTCAGAAACTCCCAGAATCCATAGGA
AAACTTACCAGCCTTGAATACCTTTCTTTGCATGGTTGCATACATTTGGATAGCCTGCCA
GATAGTTTAATGAGACTGTCGAACATAAGTTTCCTAGAGCTAGAACAGACTGCAATCGAC
CATGTTCCAAAAGGAGTTGCAAAGTTGCAGCAACTCTACAACCTTAGAGGAGTTTTTGAC
AGTGGAACTGGATTCAGACTAGATGAACTCCAATGTCTCTCCAATATCCAACGTCTCCGG
ATTGTGAAGCTAGAAAAAGCAGCACCAGGGGGTTCATTTGTACTCAAGAACTGTCTTCAT
CTTCGAGAATTGTGGCTCGGTTGCACAATCGGAGGTCATGATAAAACTTATTATCAGACC
AACGAGATTGAGAGAATTCAGCAAGTCTACGAACTGCTAATTCCATCGCCAAGCTTACTG
TATATATTTCTTGTCGGGTTCCCTGGTGTAAGGTTCCCAGATTGGTTGTGCTCAGAACCA
GAGCGTAAGATGCCAAATTTGGGTCATATGCACCTCAACGACTGCACTTCATGTTCAGTG
CTTCCACCAGCAGGCCAGATGCCAGAACTGCTAGTTTTTAAGATTAAAGGCGCAGATGCA
ATAGTGAATATGGGTGCAGAGCTGCTAGGGAAAGGCGTCAATAGCGCAAAGCATATAACT
ATTTTTCCAAAACTCGAATTGCTTCTCATCACTAACATGAGCAATTTGGAAAGTTGGTCT
CTCAACACATGGAATTTGTGTGGCAAATCTGAACAGCTTGTTCTGATGCCTTGCCTTAAG
CGTTTGTTTCTTAACGACTGCCCAAAACTAAGGGCTCTCCCTGAAGACTTGCATAGGATT
GCTAACTTAAGAAGAATCCATATCGAAGGTGCTCACACGCTGCAAGAAGTTGACAACCTT
CCTTCAGTGTTATGGCTCAAGGTCAAGAACAACAGGTGTTTGAGGAGAATTTCCAATCTC
TGTAATCTAAAGGACTTGCTTGCGCAGGACTGTCCAGCGCTGTATCAGGCAGAGAATCTA
ATCTCACTAAAGAGACTCTACATGGTCGATTGCCACAACGCGAAGCAATTCAGGATGAGC
CTCCTGGAAGACCAACAACTTGCCGTCCATGTTGTTACAGTTGGTGCAGATGGCAGGGAT
ATCTTTCCAGATGAATCTCTCTATAATTAG

Protein

990 aa

>Os01t0149500-01 NBS-LRR domain-containing protein, Rice blast disease resistance
MGTVLDALAWKFLEKLGQLIEDEVIMTLSVKRGIESLKKNLEFFNAVHEDAEALAMEDPG
IDSWWKNMRDVMFDVDDIVDLFMVHSQKLLLPPRPVCCNQPLFSSFAKFSFDHMIAKRID
NINEKFEEIKMNKEMFGLERTNGQQIQITIVDRSQTSPVDELEVVGEDIRRAIDDIVKMI
VSSNYNESRSTVFGIQGMGGIGKTTLAQKIYNEQRIREKFQVHIWLCISQNYTETSLLKQ
AIRMAGGICDQLETKTELLPLLVDTIRGKSVFLVLDDVWKSDVWIDLLRLPFLRGLNSHI
LVTSRNLDVLVEMHATYTHKVNKMNDCDGLELLMKMSLGPYEQSREFSGVGYQIVKKCDG
LPLAIKVVAGVLSTKRTRAEWESIRDSKWSIHGLPRELGGPLYLSYSNLPPELKQCFLWC
ALLPSNFVIRRDAVAYWWVAEGFVTEVHGYSIHEVAEEYYHELIRRNLLQPRPEFVDKGE
STMHDLLRSLGQFLTKDHSIFMNMEYSKALPNLRHLCISNDVEEIPAIEKQKCLRSLLVF
DNKNFMKINKDIFRELKHIRVLVLSGTSIQIIPESVGNFLLLRLLDLSYTKIQKLPESIG
KLTSLEYLSLHGCIHLDSLPDSLMRLSNISFLELEQTAIDHVPKGVAKLQQLYNLRGVFD
SGTGFRLDELQCLSNIQRLRIVKLEKAAPGGSFVLKNCLHLRELWLGCTIGGHDKTYYQT
NEIERIQQVYELLIPSPSLLYIFLVGFPGVRFPDWLCSEPERKMPNLGHMHLNDCTSCSV
LPPAGQMPELLVFKIKGADAIVNMGAELLGKGVNSAKHITIFPKLELLLITNMSNLESWS
LNTWNLCGKSEQLVLMPCLKRLFLNDCPKLRALPEDLHRIANLRRIHIEGAHTLQEVDNL
PSVLWLKVKNNRCLRRISNLCNLKDLLAQDCPALYQAENLISLKRLYMVDCHNAKQFRMS
LLEDQQLAVHVVTVGADGRDIFPDESLYN*

5'UTR

chr01:2684989..2686364 (- strand) : 1376 bp

CDS

chr01:2682019..2684988 (- strand) : 2970 bp

3'UTR

chr01:2681220..2681810 (- strand) : 591 bp

FASTA

>Os01t0149500-01 class=Sequence position=chr01:2681220..2686364 (- strand)
GTGCGGTGGG GGGCATTTCA TCGAACACCA TTCGCGCATC GCTCTCCCCG AGCGAACCGC ATTCGTTACG TTACGTTACG
TGCGAGATGA ATCAACTTGT CAGGTACAAA CACAACCGGA GAATTTGCTT TTGTTTATAC TGGAGTTATA CGATGTGATC
CTGATCCAGG CTCAGTTCGA CCTAGCCCCT GCTTATCTTT GCTTGTGGGT CGTTGTCGCC GTCTTTGGTT ACGCTAGGAG
AAGCATCTCT CTTTCTTGCG TAGGTAATCA ACTATCTTAA TTTTTCTTTT GTGTCTTGAT TATGTGCAAC ACCGAGTGAT
GCGAATGGGA TGTGTTCCTT TCGATGTTTT TTCTATATAA GCTCTGAAAC TTGGACTTTT GCAACAAATG GTTCGGGTGC
AGATGAGCTG TTTGACGAAA TGCCCAGGAG ATTCCTGCGT GCGTTGCATG CCCAGCGGCG GTTTGACTCT ATTTTTCCTT
TAGTATGGTG TCTGCTCTCT GGTGATCTAA TGTACCATTT TCTCTTAACC TTGTTTTACC CAATCTTAAT GCAAAGATGC
ATAAAGAGAA CTCTGCATAT TCCTGTTTTC TCTTAACCTT GTTTCAGAGA ACCTTGTTTT CTCTGAACTC TGCAAAAGAT
TTTCTGCATA TTCCTGAAAA AAGGAGAACT CTGCTCCGGT GCTTTTAACT AGACTTATAA AGGCTTTGGC ATAGGATTCC
TGTATTGGTT GATGCAAAAT CTGCTGGTAA CAGTCAGCTA AATTCGCTTA AAAAGTACAC TTCTTTGGGT CTTCTTGCTA
GTGCAGGTAG AGAAGCACCA TGGCCTTCCT GGTTTCTTAG GTGGTAAACA GGCAAAGAAA GTAAAGCACC AAGTGGCGCC
ATTGCTGCAA TGAAATCAAA TTATTATTAG CAAGTGGATG AAAGGAAAAG AATACACAGC CTGGAAGAGC TTTCAACTTG
AATCCCCTTG CAATTGTGTA ACACTACTTG TCCTTTTCAC ATTGCATCAT CGTTGAAACA TTTGGATTTT AATACAAAAA
TCATTGTGGG TAGATTTTGC CTCAAAAAGT GCTTTCATAC TGTTTTAATT TTGTCAGGTT TTTCAGACGT TTTGCAATAG
AGAATGTCAA TGTCCATTGT GACAAAGGCA GTTGGTGGCA AGAAAGGGAG GAGAATCTAT AACAGCTCTC TTCTGCAATC
TGCATTGCCC TCTCTGTTCT CATCAGGTTT TAGCCACACT GCTTCAATAT CTCTTTCCAT CTTCCGTATT TAAGTGATCG
GCACTCAGCA GCTCTGTGAG ATATCTCTTC TGGGATCTGC AGTTTCAAGC ATCTCCCATA GGAGAGATCC AGTGGGAATC
CGTAGGTTCT AGCACTATGG GCACAGTTTT GGATGCTCTC GCTTGGAAAT TCTTGGAAAA GCTGGGTCAA CTTATTGAGG
ATGAGGTTAT CATGACATTA AGTGTGAAAA GGGGTATTGA GAGCCTGAAG AAAAATCTGG AATTCTTCAA CGCTGTTCAT
GAGGATGCTG AGGCTCTGGC CATGGAGGAT CCAGGGATAG ATTCATGGTG GAAGAACATG AGAGATGTTA TGTTTGATGT
CGATGACATC GTAGATCTTT TCATGGTTCA TTCACAGAAG CTCTTGCTGC CACCAAGGCC GGTATGTTGC AATCAGCCCT
TGTTCTCTAG CTTTGCAAAG TTTTCATTTG ATCACATGAT TGCCAAAAGA ATTGATAATA TAAATGAAAA GTTTGAAGAA
ATTAAAATGA ACAAAGAGAT GTTTGGCTTG GAGAGAACCA ACGGGCAACA AATCCAGATA ACAATTGTTG ACAGAAGTCA
GACATCTCCT GTAGATGAAC TTGAGGTGGT TGGAGAAGAT ATCAGAAGGG CTATTGATGA CATCGTCAAA ATGATTGTTA
GTAGTAACTA CAATGAAAGC AGGTCAACTG TTTTTGGGAT CCAGGGGATG GGAGGCATCG GTAAGACAAC ATTAGCTCAA
AAGATATACA ATGAACAGAG GATAAGGGAG AAATTCCAAG TTCATATATG GTTGTGCATT TCTCAGAATT ACACAGAGAC
CAGTTTGTTA AAACAGGCAA TCAGAATGGC TGGAGGAATT TGTGATCAGC TGGAGACTAA GACTGAGCTT CTACCGCTTC
TAGTGGACAC TATTAGAGGG AAGAGTGTTT TTCTTGTGCT GGATGATGTT TGGAAATCTG ATGTATGGAT TGATCTTCTT
CGTTTGCCTT TCTTGAGAGG TTTGAATTCT CATATCCTTG TGACCTCAAG AAACCTGGAT GTTTTGGTTG AAATGCATGC
AACTTATACC CACAAGGTAA ACAAAATGAA TGATTGCGAT GGCCTAGAAC TGCTGATGAA GATGTCATTA GGGCCATACG
AGCAAAGCAG AGAATTCAGT GGTGTTGGAT ATCAAATTGT CAAAAAGTGT GATGGCCTTC CTCTTGCCAT CAAAGTTGTT
GCAGGTGTTC TATCTACTAA AAGAACAAGG GCAGAATGGG AGAGTATCCG AGATAGCAAG TGGTCCATTC ATGGACTTCC
CAGAGAACTA GGAGGCCCTC TGTACTTAAG CTACAGCAAC TTACCCCCTG AACTTAAACA ATGCTTTCTC TGGTGTGCTT
TGTTGCCGTC AAATTTTGTG ATACGTCGTG ATGCTGTCGC TTACTGGTGG GTTGCTGAAG GTTTCGTGAC GGAAGTGCAT
GGGTACTCAA TACATGAGGT TGCTGAAGAG TACTACCATG AGCTAATCAG AAGGAATCTT CTGCAGCCAC GACCAGAGTT
TGTAGACAAA GGCGAGTCAA CAATGCATGA TCTATTGAGG TCACTTGGTC AATTTTTGAC AAAGGATCAC TCCATATTCA
TGAACATGGA ATATAGCAAA GCCTTACCAA ATCTACGCCA CTTATGTATC AGCAATGATG TAGAAGAAAT ACCTGCTATA
GAAAAGCAAA AGTGCTTGAG GAGCCTCCTA GTTTTTGATA ACAAAAACTT CATGAAAATT AATAAGGACA TTTTCAGAGA
ACTCAAGCAT ATCCGTGTCT TAGTTCTCAG TGGAACAAGC ATCCAAATCA TACCAGAGTC AGTGGGAAAC TTCTTGTTAC
TGAGGCTTCT AGATCTAAGC TATACAAAAA TTCAGAAACT CCCAGAATCC ATAGGAAAAC TTACCAGCCT TGAATACCTT
TCTTTGCATG GTTGCATACA TTTGGATAGC CTGCCAGATA GTTTAATGAG ACTGTCGAAC ATAAGTTTCC TAGAGCTAGA
ACAGACTGCA ATCGACCATG TTCCAAAAGG AGTTGCAAAG TTGCAGCAAC TCTACAACCT TAGAGGAGTT TTTGACAGTG
GAACTGGATT CAGACTAGAT GAACTCCAAT GTCTCTCCAA TATCCAACGT CTCCGGATTG TGAAGCTAGA AAAAGCAGCA
CCAGGGGGTT CATTTGTACT CAAGAACTGT CTTCATCTTC GAGAATTGTG GCTCGGTTGC ACAATCGGAG GTCATGATAA
AACTTATTAT CAGACCAACG AGATTGAGAG AATTCAGCAA GTCTACGAAC TGCTAATTCC ATCGCCAAGC TTACTGTATA
TATTTCTTGT CGGGTTCCCT GGTGTAAGGT TCCCAGATTG GTTGTGCTCA GAACCAGAGC GTAAGATGCC AAATTTGGGT
CATATGCACC TCAACGACTG CACTTCATGT TCAGTGCTTC CACCAGCAGG CCAGATGCCA GAACTGCTAG TTTTTAAGAT
TAAAGGCGCA GATGCAATAG TGAATATGGG TGCAGAGCTG CTAGGGAAAG GCGTCAATAG CGCAAAGCAT ATAACTATTT
TTCCAAAACT CGAATTGCTT CTCATCACTA ACATGAGCAA TTTGGAAAGT TGGTCTCTCA ACACATGGAA TTTGTGTGGC
AAATCTGAAC AGCTTGTTCT GATGCCTTGC CTTAAGCGTT TGTTTCTTAA CGACTGCCCA AAACTAAGGG CTCTCCCTGA
AGACTTGCAT AGGATTGCTA ACTTAAGAAG AATCCATATC GAAGGTGCTC ACACGCTGCA AGAAGTTGAC AACCTTCCTT
CAGTGTTATG GCTCAAGGTC AAGAACAACA GGTGTTTGAG GAGAATTTCC AATCTCTGTA ATCTAAAGGA CTTGCTTGCG
CAGGACTGTC CAGCGCTGTA TCAGGCAGAG AATCTAATCT CACTAAAGAG ACTCTACATG GTCGATTGCC ACAACGCGAA
GCAATTCAGG ATGAGCCTCC TGGAAGACCA ACAACTTGCC GTCCATGTTG TTACAGTTGG TGCAGATGGC AGGGATATCT
TTCCAGATGA ATCTCTCTAT AATTAGGCAG GTGAGCAATT TACTCTACAA ATTATTAGAG GAAGTTCTAC TACATTTATT
TGTTAGTCTC GATCTTTTCC TTTGATTCTG TTTGTACTAT GGTTTGGTTT ATCTTTTGTT TTTGTAATTC TGGCTATTGC
ACCGAGACAT CATAATTTAA ACTATTTACA ATCAAAATAT CCTTCATTTA ATCATTTTGT CACTCTTCTT GCAGTACTAG
AGTGGAGCGC ACTTAAGGAA ATGGTGATAC TAGTGCACCT GAAATGTTAC AGGAAAACAA TTCAATTTCT GTGGTAAGTG
GTAGCCAATG GTATTCAAAA TGCAGTCCAG TGGTAAATGC AGCTTGGTGC AGTCCTAACA GAAGGAAGCA ACATCGTTTA
CCGAGATTAT AGCTTGAATT CATCAGCTTA ATATAAATGC AAAAATTTGG AAACTTGGTC AGCACTGTCG AAAACTAGAT
ATCCCTTCAG GTGAAGTTGC CTGACTCAAG GTTAAGACTA ACATCAATTT GCCACTGCTG GAGGTAAGAA CGGTGGGTGT
AAATGCTGCC TCGATTGCAG CATAGTGTGA TGCTATCTCC AAGACTGATT CAGGCTGAGC AGCCTCTGAG AGCTTGTGCA
GATTTCAAAT CCAACGAGTT TTTGAACATG TTCTTGTCCG TTGGGCTCCT CCATGTAAAT ATCTTGAACA GCATGACCAA
TAGACGTTCC CAGTACTCAA TACAAATACT TTTCAGGACT TCAGATCGAT CAACATGTTA AACTTGGAAT ATGCAAGAAC
TGGGTGTGAT AAACAACGAT CGAAG