Os01t0172100-01

Locus

Os01g0172100

Description

Similar to Triose phosphate/phosphate translocator, non-green plastid, chloroplast precursor (CTPT).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PPT3

CGSNL Gene Name

PHOSPHOENOLPYRUVATE/PHOSPHATE TRANSLOCATOR 3

Oryzabase Gene Symbol Synonym(s)

OsPPT3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK060343 (DDBJ, Best hit)

Protein Evidence

Q5VQL3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Drug/metabolite transporter (IPR000620)

Tpt phosphate/phosphoenolpyruvate translocator (IPR004696)

Domain of unknown function DUF250 (IPR004853)

Full-length cDNA

001-008-E01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0172100-01)

RiceXPro (AK060343)

Others

Oryzabase (8717)

KEGG (Os01t0172100-01)

Transcript

1652 bp

>Os01t0172100-01 Similar to Triose phosphate/phosphate translocator, non-green plastid, chloroplast precursor (CTPT).
CTCTTTGTGTTTGATTATTCGTTCCGGTGTGCGCGAAAGCGGGGAAGGAGCGGGGTACGC
ATCTGTACCTGTACGGGATCCCGGCGAGATTCAACCTTGCAACCTCATGTCCTTGTGTTC
ATGTGCTCGTACGATACGAAAATAGAATTCTGATACGTCTGTATAATATAGGGGTGAGAG
GGTGCCACTGCCAACTGGTCACCTAGCCCAGAAACCCGGCAAGATGCAGCGCGCGGCGGC
GGCCTCGCGCGCCACGGCATGGAGCACGGCACGGCACGGCGCCGCCCGCGTCACCGCCTC
CGCCTCCTTCTCCGGCGGCGGCGGCATCGTCGCCGGTGCGGCGCTGCCGCTCCGTGTTCG
CGGCGGCCAGCTCATGTCCCTGCCGCTGCTGTCGGGTGGCAGGGCGGTCACGGCGAGGGT
GGCGGCGGCGGAGGCGCCGTTGCCGGCGGACGACGCCGACGCGGCGGCTGGGCGGGAGAG
AGGCGCACTCGCGGAGACGGCGCAGCTGGGCGCCATGATCGTGGCGTGGTACCTCCTCAA
CATCTACTTCAACATCTACAACAAGCAGGTGCTGCAGCCATTGCCGTTCCCCTACACCAT
CACCGCCTTCCAGCTCGCGTTCGGCTCCTTCGTCATCTTCCTCATGTGGGCGCTCAAGCT
TCATCCCGCGCCCAGAATCTCCATTTCACAGCTGGCCAAGATCGCGCCGCTCGCCGCCGG
GCACATGCTGGGCACGGTGTTCACCAACATGAGCCTGAGCAAGGTCGCCGTCTCCTTCAC
CCACACCATCAAGGCGTCCGAGCCCTTCTTCACCGTCCTCCTCTCCGCCTTCTTCCTCGG
CGAGACGCCTTCGCTGCTGGTGCTGGGCTCCCTCGTGCCGATCGTCGGCGGCGTCGCCTT
GGCATCGTTGACTGAACTCTCTTTCAACTGGATTGGGTTCTGGAGTGCGATGGCATCGAA
TCTTCTATACCAATCAAGAAATGTGCTCAGCAAGAAGCTTCTTGGCGGCGAAGAGGAAGC
GTTGGATGACATAAACCTCTTCTCAATACTCACTATACTGTCATTTCTGCTGTCTTTGCC
TCTGATGCTGTTCTCAGAAGGGGTCAAGTTCAGCCCAGGATACCTCCGGAGCACTGGCCT
TAACCTCCAAGAGCTGTGTGTAAGAGCAGCACTAGCTGGCTTTTGCTTCCATGGCTACCA
GAAGCTCTCCTACTTGATCCTGGCCAGAGTGTCACCTGTCACCCACTCTGTCGCCAACTG
CGTCAAGCGTGTGGTCGTCATCGTGGCGTCTGTTCTCTTCTTCAGAACCCCAATTTCACC
TGTCAATGCACTAGGAACTGGTGTTGCATTGGGAGGAGTTTTCCTGTATTCCAGGTTGAA
GAGAACAAAACCAAAGAATGCCTGAGAAGAGAGGACACGCTTAATTACAGTTCTCGCAGT
TTTTGTTTTGATTTGGGATACATAGATTAGGCTTGTACATCGACGAAGAAAATGAGTTGG
GTTCGGTTTTAGCACCGATTGTACTACACGACCTACAGTCTCATTTTTCACAAAATTGTA
AGAACATTGCTGAATATTCTCAGATCTCGAGAGAAATTCATTAGTGTCCAGGCGCAAAAT
CAATAAAGCTATCACTTGAGTGTACGCTTGAG

CDS

1182 bp

>Os01t0172100-01 Similar to Triose phosphate/phosphate translocator, non-green plastid, chloroplast precursor (CTPT).
ATGCAGCGCGCGGCGGCGGCCTCGCGCGCCACGGCATGGAGCACGGCACGGCACGGCGCC
GCCCGCGTCACCGCCTCCGCCTCCTTCTCCGGCGGCGGCGGCATCGTCGCCGGTGCGGCG
CTGCCGCTCCGTGTTCGCGGCGGCCAGCTCATGTCCCTGCCGCTGCTGTCGGGTGGCAGG
GCGGTCACGGCGAGGGTGGCGGCGGCGGAGGCGCCGTTGCCGGCGGACGACGCCGACGCG
GCGGCTGGGCGGGAGAGAGGCGCACTCGCGGAGACGGCGCAGCTGGGCGCCATGATCGTG
GCGTGGTACCTCCTCAACATCTACTTCAACATCTACAACAAGCAGGTGCTGCAGCCATTG
CCGTTCCCCTACACCATCACCGCCTTCCAGCTCGCGTTCGGCTCCTTCGTCATCTTCCTC
ATGTGGGCGCTCAAGCTTCATCCCGCGCCCAGAATCTCCATTTCACAGCTGGCCAAGATC
GCGCCGCTCGCCGCCGGGCACATGCTGGGCACGGTGTTCACCAACATGAGCCTGAGCAAG
GTCGCCGTCTCCTTCACCCACACCATCAAGGCGTCCGAGCCCTTCTTCACCGTCCTCCTC
TCCGCCTTCTTCCTCGGCGAGACGCCTTCGCTGCTGGTGCTGGGCTCCCTCGTGCCGATC
GTCGGCGGCGTCGCCTTGGCATCGTTGACTGAACTCTCTTTCAACTGGATTGGGTTCTGG
AGTGCGATGGCATCGAATCTTCTATACCAATCAAGAAATGTGCTCAGCAAGAAGCTTCTT
GGCGGCGAAGAGGAAGCGTTGGATGACATAAACCTCTTCTCAATACTCACTATACTGTCA
TTTCTGCTGTCTTTGCCTCTGATGCTGTTCTCAGAAGGGGTCAAGTTCAGCCCAGGATAC
CTCCGGAGCACTGGCCTTAACCTCCAAGAGCTGTGTGTAAGAGCAGCACTAGCTGGCTTT
TGCTTCCATGGCTACCAGAAGCTCTCCTACTTGATCCTGGCCAGAGTGTCACCTGTCACC
CACTCTGTCGCCAACTGCGTCAAGCGTGTGGTCGTCATCGTGGCGTCTGTTCTCTTCTTC
AGAACCCCAATTTCACCTGTCAATGCACTAGGAACTGGTGTTGCATTGGGAGGAGTTTTC
CTGTATTCCAGGTTGAAGAGAACAAAACCAAAGAATGCCTGA

Protein

394 aa

>Os01t0172100-01 Similar to Triose phosphate/phosphate translocator, non-green plastid, chloroplast precursor (CTPT).
MQRAAAASRATAWSTARHGAARVTASASFSGGGGIVAGAALPLRVRGGQLMSLPLLSGGR
AVTARVAAAEAPLPADDADAAAGRERGALAETAQLGAMIVAWYLLNIYFNIYNKQVLQPL
PFPYTITAFQLAFGSFVIFLMWALKLHPAPRISISQLAKIAPLAAGHMLGTVFTNMSLSK
VAVSFTHTIKASEPFFTVLLSAFFLGETPSLLVLGSLVPIVGGVALASLTELSFNWIGFW
SAMASNLLYQSRNVLSKKLLGGEEEALDDINLFSILTILSFLLSLPLMLFSEGVKFSPGY
LRSTGLNLQELCVRAALAGFCFHGYQKLSYLILARVSPVTHSVANCVKRVVVIVASVLFF
RTPISPVNALGTGVALGGVFLYSRLKRTKPKNA*

5'UTR

chr01:3711212..3711434 (+ strand) : 223 bp

CDS

chr01:3711435..3711779 (+ strand) : 345 bp

chr01:3711858..3711980 (+ strand) : 123 bp

chr01:3712086..3712238 (+ strand) : 153 bp

chr01:3712323..3712408 (+ strand) : 86 bp

chr01:3712533..3712617 (+ strand) : 85 bp

chr01:3712705..3712824 (+ strand) : 120 bp

chr01:3712906..3712974 (+ strand) : 69 bp

chr01:3713088..3713217 (+ strand) : 130 bp

chr01:3713336..3713406 (+ strand) : 71 bp

3'UTR

chr01:3713407..3713653 (+ strand) : 247 bp

FASTA

>Os01t0172100-01 class=Sequence position=chr01:3711212..3713653 (+ strand)
CTCTTTGTGT TTGATTATTC GTTCCGGTGT GCGCGAAAGC GGGGAAGGAG CGGGGTACGC ATCTGTACCT GTACGGGATC
CCGGCGAGAT TCAACCTTGC AACCTCATGT CCTTGTGTTC ATGTGCTCGT ACGATACGAA AATAGAATTC TGATACGTCT
GTATAATATA GGGGTGAGAG GGTGCCACTG CCAACTGGTC ACCTAGCCCA GAAACCCGGC AAGATGCAGC GCGCGGCGGC
GGCCTCGCGC GCCACGGCAT GGAGCACGGC ACGGCACGGC GCCGCCCGCG TCACCGCCTC CGCCTCCTTC TCCGGCGGCG
GCGGCATCGT CGCCGGTGCG GCGCTGCCGC TCCGTGTTCG CGGCGGCCAG CTCATGTCCC TGCCGCTGCT GTCGGGTGGC
AGGGCGGTCA CGGCGAGGGT GGCGGCGGCG GAGGCGCCGT TGCCGGCGGA CGACGCCGAC GCGGCGGCTG GGCGGGAGAG
AGGCGCACTC GCGGAGACGG CGCAGCTGGG CGCCATGATC GTGGCGTGGT ACCTCCTCAA CATCTACTTC AACATCTACA
ACAAGCAGGT CTTCCTCCCC CCTCAAGAAC CTTCTCCTTC CTCATCCTCG CCATCTCTTA ACCCAATCAG CCATGGAGAA
TCTCAGGTGC TGCAGCCATT GCCGTTCCCC TACACCATCA CCGCCTTCCA GCTCGCGTTC GGCTCCTTCG TCATCTTCCT
CATGTGGGCG CTCAAGCTTC ATCCCGCGCC CAGAATCTCC ATTTCACAGG TGAGATGATT TGGTTTCTTG CAACCAACAA
TGGAGAAAGA AACATGTGCA ATGTGATTGT CCGCGATTGC TGAATTCTTC TGAAATTTTC GGTTCTCGCC GCAGCTGGCC
AAGATCGCGC CGCTCGCCGC CGGGCACATG CTGGGCACGG TGTTCACCAA CATGAGCCTG AGCAAGGTCG CCGTCTCCTT
CACCCACACC ATCAAGGCGT CCGAGCCCTT CTTCACCGTC CTCCTCTCCG CCTTCTTCCT CGGCGAGGTG GGTGACACAA
TTCAGTGGGT TCCTGTCAAT CGATTCAGAG ATGAAATTGG TGCTGAATTC AAATTTGTGT TTGAATTGCA GACGCCTTCG
CTGCTGGTGC TGGGCTCCCT CGTGCCGATC GTCGGCGGCG TCGCCTTGGC ATCGTTGACT GAACTCTCTT TCAACTGGTA
GAATCTGAAT CTCTGACGAA CACCATATAT CTGAATGAAT TTTTAATTTG TTCTTTTGTT GTTCCTGAAA CTGAATGATT
GTGGGGGAAT CTTTTCTCAC TCTCTGATTT TGTGGGATCA GGATTGGGTT CTGGAGTGCG ATGGCATCGA ATCTTCTATA
CCAATCAAGA AATGTGCTCA GCAAGAAGCT TCTTGGCGGC GAAGAGGTGA ATTTTGTTCC CCAGTGATTA CAGTCTCTCG
CTTCTTTCGA AGCCGGTAAT TCGATTCCTA ACAGAGATTA TCTTTTGATG CAGGAAGCGT TGGATGACAT AAACCTCTTC
TCAATACTCA CTATACTGTC ATTTCTGCTG TCTTTGCCTC TGATGCTGTT CTCAGAAGGG GTCAAGTTCA GCCCAGGATA
CCTCCGGAGC ACTGTGAGTG TTTGAAAAAT TCAGATAAAC AGACACTATT CCCAAAAATA TATGAACAAA TGGAATGTCC
TGTTTGGCTT GCAGGGCCTT AACCTCCAAG AGCTGTGTGT AAGAGCAGCA CTAGCTGGCT TTTGCTTCCA TGGCTACCAG
AAGGTGAGGA CTGAGGAAAC AGTCACCTCT TCTTTGGCTC AAGAAAGATT TGTGCTTGAT GATTCATTGA CCTGTAAACA
AAAGGATCAT TCTGTGTTCT TTCTTGAAAT TGGCAGCTCT CCTACTTGAT CCTGGCCAGA GTGTCACCTG TCACCCACTC
TGTCGCCAAC TGCGTCAAGC GTGTGGTCGT CATCGTGGCG TCTGTTCTCT TCTTCAGAAC CCCAATTTCA CCTGTCAATG
CACTAGGTAC TGTAACTCTC AAAAAACTGG CTGATTTTCT TCAGAACTTA ACAGCAGCTG AAAGTTTTGC TGTTCTTGTG
TTTAACTAAT TTTTGTTTGG ATTTCTTTTT GTGCCAACCT GCAGGAACTG GTGTTGCATT GGGAGGAGTT TTCCTGTATT
CCAGGTTGAA GAGAACAAAA CCAAAGAATG CCTGAGAAGA GAGGACACGC TTAATTACAG TTCTCGCAGT TTTTGTTTTG
ATTTGGGATA CATAGATTAG GCTTGTACAT CGACGAAGAA AATGAGTTGG GTTCGGTTTT AGCACCGATT GTACTACACG
ACCTACAGTC TCATTTTTCA CAAAATTGTA AGAACATTGC TGAATATTCT CAGATCTCGA GAGAAATTCA TTAGTGTCCA
GGCGCAAAAT CAATAAAGCT ATCACTTGAG TGTACGCTTG AG

Locus: Os01g0172100

Loading...

Locus: Os01g0172100

Loading...