Os01t0174000-01

Locus

Os01g0174000

Description

bZIP transcription factor, Homolog of Arabidopsis HY5 transcription factor, Regulation of heading date

RAP-DB Gene Symbol Synonym(s)

OsHY5L3, OsbZIP01, OsRE1

RAP-DB Gene Name Synonym(s)

LONG HYPOCOTYL 5 LIKE 3, HY5-like 3, b-ZIP transcription factor 01, Regulator of Ehd1

CGSNL Gene Symbol

BZIP1

CGSNL Gene Name

b-ZIP TRANSCRIPTION FACTOR 1

Oryzabase Gene Symbol Synonym(s)

OsbZIP01, OsbZIP1, OsRE1, RE1

Oryzabase Gene Name Synonym(s)

b-ZIP transcription factor 01, regulator of Ehd1

Transcript Evidence

EU976642 (maize)

Protein Evidence

Q0JQA4

Literature

PMID: 32757315

PMID: 31084872

PMID: 28775143

Note

Manual Curation

August 7, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

Basic-leucine zipper domain (IPR004827)

Expression Databases

TENOR (Os01t0174000-00)

Others

Oryzabase (10092)

Transcript

918 bp

>Os01t0174000-01 bZIP transcription factor, Homolog of Arabidopsis HY5 transcription factor, Regulation of heading date
GATTTTCTTTTTTTTTCTTCCCTTTTTCGCGGCGGCGAGGGGCGAGGGGGGAGGGTGAGT
GTGGTGTGGTGTGGTGGTTGGTGGGGGAGATCTTGATCTGGTCGTTGGAGATGGCGGCGC
AGGAGCAGGAGCAGGAGAAGCAGCAGGTGAAGACGAGCACGACGAGCTCGCTGCCGTCGA
GCAGCGAGCGCTCCTCCAGCTCAGCCCCCAACAACCTCAAGGAAGGAGGAGGGGTGGAGA
GCGACGAGGAGATACGGCGGGTGCCGGAGATGGGAGGGGGCGGCGGGTCGGCGTCGTCGG
GGGCGGGGGCGGACGAGCGGCAGGGGAAGGAGGACGGGAAGCAGCAGGGTGGTGGCGGCG
GCGGGGCGGCGGCGGCGGGGGGCGGGCAGGAGCAGGCGCCGCCGGCGAGGAAGCGAGGGC
GGAGCGCCGGCGACAAGGAGCAGAACCGGCTGAAGCGGCTGCTGCGGAACCGCGTGTCGG
CGCAGCAGGCGCGGGAGCGGAAGAAGGCGTACATGACGGAGCTCGAGGCCAAGGCCAAGG
ACCTCGAGCTCCGCAATGCCGAGCTCGAGCAGCGCGTCTCCACCCTCCAGAACGAGAACA
ACACGCTCCGCCAGATACTCAAGAACACGACGGCGCACGCCGGCAAGAGGGGCGGCGGCG
GCGGAGGCAAGGGCGGCGATGGCGGCGGCGGCGGGAAGAAGCACCATTTCACCAAGAGCT
AGGAGGAGAGGGACTGCGGTGACGGCGGCGGCGGAGGCAGGGTTGTGGTAGGAATTGAAT
TGTTCATCTGATCTGACCATTGTTAGGAAACATCATCGATGTTGTTGTTGTTGTTGTTGA
CGTTTTTCTTTTTTTTTCTTCTTCTCTGTTCTACTCTACGCTTCGTCGACTGCTTCGGTG
ATGGTTGCAATTACTGTT

CDS

612 bp

>Os01t0174000-01 bZIP transcription factor, Homolog of Arabidopsis HY5 transcription factor, Regulation of heading date
ATGGCGGCGCAGGAGCAGGAGCAGGAGAAGCAGCAGGTGAAGACGAGCACGACGAGCTCG
CTGCCGTCGAGCAGCGAGCGCTCCTCCAGCTCAGCCCCCAACAACCTCAAGGAAGGAGGA
GGGGTGGAGAGCGACGAGGAGATACGGCGGGTGCCGGAGATGGGAGGGGGCGGCGGGTCG
GCGTCGTCGGGGGCGGGGGCGGACGAGCGGCAGGGGAAGGAGGACGGGAAGCAGCAGGGT
GGTGGCGGCGGCGGGGCGGCGGCGGCGGGGGGCGGGCAGGAGCAGGCGCCGCCGGCGAGG
AAGCGAGGGCGGAGCGCCGGCGACAAGGAGCAGAACCGGCTGAAGCGGCTGCTGCGGAAC
CGCGTGTCGGCGCAGCAGGCGCGGGAGCGGAAGAAGGCGTACATGACGGAGCTCGAGGCC
AAGGCCAAGGACCTCGAGCTCCGCAATGCCGAGCTCGAGCAGCGCGTCTCCACCCTCCAG
AACGAGAACAACACGCTCCGCCAGATACTCAAGAACACGACGGCGCACGCCGGCAAGAGG
GGCGGCGGCGGCGGAGGCAAGGGCGGCGATGGCGGCGGCGGCGGGAAGAAGCACCATTTC
ACCAAGAGCTAG

Protein

204 aa

>Os01t0174000-01 bZIP transcription factor, Homolog of Arabidopsis HY5 transcription factor, Regulation of heading date
MAAQEQEQEKQQVKTSTTSSLPSSSERSSSSAPNNLKEGGGVESDEEIRRVPEMGGGGGS
ASSGAGADERQGKEDGKQQGGGGGGAAAAGGGQEQAPPARKRGRSAGDKEQNRLKRLLRN
RVSAQQARERKKAYMTELEAKAKDLELRNAELEQRVSTLQNENNTLRQILKNTTAHAGKR
GGGGGGKGGDGGGGGKKHHFTKS*

5'UTR

chr01:3812070..3812179 (- strand) : 110 bp

CDS

chr01:3811949..3812069 (- strand) : 121 bp

chr01:3811469..3811851 (- strand) : 383 bp

chr01:3811290..3811397 (- strand) : 108 bp

3'UTR

chr01:3811094..3811289 (- strand) : 196 bp

FASTA

>Os01t0174000-01 class=Sequence position=chr01:3811094..3812179 (- strand)
GATTTTCTTT TTTTTTCTTC CCTTTTTCGC GGCGGCGAGG GGCGAGGGGG GAGGGTGAGT GTGGTGTGGT GTGGTGGTTG
GTGGGGGAGA TCTTGATCTG GTCGTTGGAG ATGGCGGCGC AGGAGCAGGA GCAGGAGAAG CAGCAGGTGA AGACGAGCAC
GACGAGCTCG CTGCCGTCGA GCAGCGAGCG CTCCTCCAGC TCAGCCCCCA ACAACCTCAA GGAAGGAGGA GGTAACGTCA
CGTTCTCCGT CGGCCGTCCG TACGCCGGAT TTCCTTTGCT TGTTTTGTTG TTTGCTGCTG AATTGAGCGA GCGATTCGGT
GGCGGCAGGG GTGGAGAGCG ACGAGGAGAT ACGGCGGGTG CCGGAGATGG GAGGGGGCGG CGGGTCGGCG TCGTCGGGGG
CGGGGGCGGA CGAGCGGCAG GGGAAGGAGG ACGGGAAGCA GCAGGGTGGT GGCGGCGGCG GGGCGGCGGC GGCGGGGGGC
GGGCAGGAGC AGGCGCCGCC GGCGAGGAAG CGAGGGCGGA GCGCCGGCGA CAAGGAGCAG AACCGGCTGA AGCGGCTGCT
GCGGAACCGC GTGTCGGCGC AGCAGGCGCG GGAGCGGAAG AAGGCGTACA TGACGGAGCT CGAGGCCAAG GCCAAGGACC
TCGAGCTCCG CAATGCCGAG CTCGAGCAGC GCGTCTCCAC CCTCCAGAAC GAGAACAACA CGCTCCGCCA GGTAAAGCCC
CCTCGAGCTT TGCTTCACCA TTCTCAATCT CTCATGGCGA TTTCTCCTCT ACTCTCCTAT AGATACTCAA GAACACGACG
GCGCACGCCG GCAAGAGGGG CGGCGGCGGC GGAGGCAAGG GCGGCGATGG CGGCGGCGGC GGGAAGAAGC ACCATTTCAC
CAAGAGCTAG GAGGAGAGGG ACTGCGGTGA CGGCGGCGGC GGAGGCAGGG TTGTGGTAGG AATTGAATTG TTCATCTGAT
CTGACCATTG TTAGGAAACA TCATCGATGT TGTTGTTGTT GTTGTTGACG TTTTTCTTTT TTTTTCTTCT TCTCTGTTCT
ACTCTACGCT TCGTCGACTG CTTCGGTGAT GGTTGCAATT ACTGTT

Locus: Os01g0174000

Loading...

Locus: Os01g0174000

Loading...