Os01t0177900-01

Locus

Os01g0177900

Description

ATP-binding cassette transporter, Cuticle formation, Defense response

RAP-DB Gene Symbol Synonym(s)

PDR6, OsPDR6, OsABCG31, OsABCG31_1

RAP-DB Gene Name Synonym(s)

PLEIOTROPIC DRUG RESISTANCE 6, sativa pleiotropic drug resistance 6, Pleiotropic drug resistance protein 6, ABC transporter superfamily ABCG subgroup member 31

CGSNL Gene Symbol

PDR6

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 6

Oryzabase Gene Symbol Synonym(s)

OsPDR6, OsABCG31, OsABCG31_1

Oryzabase Gene Name Synonym(s)

sativa pleiotropic drug resistance 6, Pleiotropic drug resistance protein 6, ABC transporter superfamily ABCG subgroup member 31, ATP-binding Cassette Transporter G31

Transcript Evidence

AJ535049

Protein Evidence

Q8GU87

Literature

PMID: 27121976

PMID: 12644668

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 20, 2016

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

ABC-transporter extracellular N-terminal domain (IPR029481)

ABC transporter-like (IPR003439)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

AAA+ ATPase domain (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Expression Databases

TENOR (Os01t0177900-01)

Others

Oryzabase (8339)

Transcript

4409 bp

>Os01t0177900-01 ATP-binding cassette transporter, Cuticle formation, Defense response
atgtgggcggcggaggcggcgttcgcgaggtcggggtcgtggagggaggaggaggacgag
caggaggcgctgcggtgggcggcgctgcagcggctgccgacggtggcgcgcgcgaggagg
ggCCTGCTCAGGTCGCCCGCGCCGGGGGAGGACCGGGTCCAGGGCGACGACGCGCTCTGC
GAGGTCGACGTCGCGGGCCTCTCCCCCGGCGACCGCACCGCCCTCGTCGATCGCCTCCTC
GCCGACTCCGGCGACGTTGAGGACTTCTTCCGCCGCATCCGCTCCCGCTTCGACGCAGTG
CAGATAGAGTTCCCCAAGATCGAAGTGAGGTACGAGGATCTGACAGTGGACGCATACGTG
CATGTCGGGAGCAGGGCGCTGCCAACCATCCCAAACTTCATTTGCAACATGACAGAGGCA
TTTCTGAGGCATTTGAGGATCTATCGAGGGGGAAGAGTGAAGTTGCCGATATTGGATAAT
GTTAGTGGGATCATTCGTCCATCAAGAATGACACTGCTATTGGGCCCTCCAAGTTCAGGA
AAGACAACCTTGCTTTTAGCCCTTGCCGGACGGCTTGGCCCTGGACTAAAGGTGTCTGGA
AATATCACTTACAACGGCCATCATCTGAATGAATTTGTGCCCCAGAGAACATCTGCTTAT
GTCAGTCAGCAAGACTGGCATGCCTCAGAGATGACGGTCAGAGAAACCTTAGAGTTTGCT
GGGCGCTGTCAGGGTGTTGGAATAAAGTATGATATGCTCGTTGAACTCTTGAGGAGAGAA
AAGAATGAAGGTATAAAACCCGATGAGGACCTTGATGTGTTCATGAAGGCATTGGCTCTT
GAGGGGAAGCAGACAAGCCTTGTCGCAGAATATATAATGAAGGTATATGGGCTGGACATT
TGTGCGGACACAATTGTTGGTGATGAAATGATCAAAGGAATCTCTGGGGGACAAAAGAAG
CGCCTGACAACAGGTGAGCTGTTAGTTGGTTCTGCTCGTGTGCTGTTCATGGATGAGATA
TCTACTGGACTTGACAGTGCAACCACATATCAGATTATCAAGTATTTAAGGCATTCTACT
CATGCTCTTGACGGCACTACAATCATATCCTTGTTGCAACCAGCTCCAGAAACTTACGAA
CTATTTGACGATGTCATCCTCATATCTGAAGGGCAAATTGTATATCAGGGACCACGTGAA
TATGCTGTTGATTTTTTTGCCGGTATGGGATTCAGATGTCCTGAAAGAAAAAACGTCGCT
GACTTCTTGCAAGAAGTTTTGTCCAAGAAAGACCAGCAACAATATTGGTGCCACTATGAT
TATCCTTACCAGTATGTCTCTGTATCAAAATTTGCTGAAGCCTTTAAAACATTTGTTATT
GGCAAGAGGCTGCACGATGAGTTAGCAGTTCCATACAATAGACATCGCAATCATCCCGCA
GCTCTTTCAACATCAAATTATGGTGTAAGGAGGCTTGAGCTTCTAAAGTCCAACTTTCAA
TGGCAGCATCTGCTGATGAAAAGGAATTCGTTCATCTATGTCTTCAAATTCATTCAGCTT
TTACTTGTTGCCCTCATCACAATGACAGTGTTTTTCCGATCAACAATGCACCGTGACTCA
GTTGATGATGGGATTATTTATCTTGGAGCCCTCTATTTTGCAATAGTGATGATTCTATTT
AATGGCTTTACTGAAGTCTCACTCTTGGTCACGAAGCTTCCAATTCTTTACAAGCACAGG
GATTTGCACTTCTACCCTCCATGGGCTTACACACTTCCGTCTTGGCTCTTGAGCATTCCA
ACCTCGCTTATTGAATCAGGAATGTGGGTACTAGTAACATATTATGTGGTCGGCTATGAT
CCCCAATTTACAAGATGTCTTGGACAATTTCTCTTGCTCTTTTTTCTACACCAAACATCT
TTGGCTCTTTTCCGGGTCATGGCATCTTTGGGTCGGAACATGATAGTCGCTAACACCTTT
GGATCGTTTGCTTTGTTGGTTGTTATGATCCTTGGAGGATTCATTATAACCAAAGAGAGC
ATACCAGCCTGGTGGATTTGGGGTTATTGGATATCTCCTATGATGTATGCACAAAATGCT
ATTTCCGTAAATGAATTCCTTGGCCATTCTTGGAGCCAGCAATTTGCAAACCAGAACATC
ACATTAGGGGAGGCAATACTCACTGGATATGGATTATTCAAGGAGAAATACTGGTTCTGG
ATTGGGGTTGGAGCATTGTTTGGTTATGCAATTGTTTTGAACTTCTTATTCACATTGTTC
TTGACTCTTCTCAACCCTATTGGGAATATACAAGCTGTTGTGTCCAAAGATGATATTCAG
CATAGGGCTCCTAGGAGGAAGAATGGCAAATTAGCCCTAGAGCTAAGATCTTACCTGCAC
TCAGCTTCATTGAATGGGCATAATCTCAAGGACCAGAAGGGCATGGTGTTACCATTTCAA
CCCCTTTCTATGTGCTTTAAGAACATCAACTACTACGTTGATGTACCAGCGGAATTGAAA
AGTCAAGGTATAGTAGAAGACCGCCTACAGTTGCTTATTGATGTCACTGGAGCATTTAGG
CCAGGGATACTAACAGCACTTGTTGGAGTAAGTGGAGCTGGCAAAACCACCCTCATGGAT
GTTTTAGCTGGCCGGAAAACTGGAGGACTAATAGAAGGAAGCATCACTATATCTGGGTAT
CCTAAAAACCAAGAGACTTTCACTAGGATCTCTGGTTATTGTGAACAAAATGATGTGCAT
TCACCTTGCTTGACTGTAATTGAGTCATTGCTGTACTCTGCATGCCTCCGATTGCCTTCT
CATGTTGATGTGAACACTCGAAGGGTTTTTGTTGAAGAGGTGATGGAACTTGTTGAGCTA
AATGCATTAAGTGGTGCTCTTGTTGGCCTACCAGGAGTGAATGGTCTGTCAACTGAACAA
CGCAAGAGGTTGACGATAGCTGTGGAGCTTGTGGCAAATCCTTCAATCGTGTTCATGGAT
GAACCTACATCAGGATTGGATGCTAGGTCAGCAGCTATTGTGATGAGAACCGTACGGAAT
ATTGTTAATACAGGACGGACAATTGTGTGCACCATCCATCAGCCAAGCATCGACATATTC
GAGTCATTTGATGAGCTTTTGTTCATGAAGCGTGGGGGGCAACTTATATATGCTGGTCCC
TTGGGCTCGAAATCACGCAATCTGGTCGAGTTTTTTGAGGCAATTCCAGGAGTTCCTAAA
ATCAGGGATGGCTATAATCCTGCTGCATGGATGTTGGAAGTCACAAGTACTCAAATGGAG
CAAATTCTTGGAGTGGATTTTGCTGAATACTACCGGCAGTCAAAATTATTTCAGCAGACC
CAAGAAATGGTTGATATCCTGAGCAGACCAAGAAGAGAATCAAAAGAACTTACTTTTGCC
ACCAAGTATTCCCAACCATTCTTTGCTCAATATGCTGCTTGCTTATGGAAGCAGAACCTG
TCGTACTGGAGAAATCCTCAATACACTGCGGTCCGATTCTTCTACACCGTCATCATTTCC
TTGATGTTCGGGACAATCTGCTGGAAATTTGGGTCTCGAAGGGAGACCCAACATGACATA
TTCAATGCCATGGGTGCCATGTACGCAGCAGTACTCTTCATAGGAATCACTAACGCCACC
TCTGTTCAACCTGTGATTTCCATCGAAAGATTTGTCTCGTACAGAGAGAGGGCAGCTGGG
ATGTACTCGGCACTGCCTTTTGCATTCTCCCTGGTTACAGTGGAGTTCCCTTACATTCTT
GTGCAGTCACTTATCTACGGCACGATTTTCTACAGCTTGGGCTCGTTCGAGTGGACAGCA
GTGAAGTTCTTGTGGTACCTGTTCTTCATGTACTTCACCTTGCTGTACTTCACTTTCTAT
GGCATGATGACAACGGCGATCACTCCCAACCACACTGTTGCGCCTATTATTGCTGCTCCA
TTCTACACGCTGTGGAATCTCTTCTGTGGGTTCATGATCCCAAGAAAGAGGATTCCTGCG
TGGTGGAGGTGGTATTACTGGGCCAACCCGGTGTCATGGACCCTGTACGGCCTGCTAACC
TCCCAGTTCGGCGACCTGGATCAGCCGCTGCTGCTCGCCGACGGCATCACCACCACCACC
GCCGTCGACTTCCTCCGGGACCACTTCGGCTTCCGCCACGACTTCCTCGGCGTCGTCGCC
GGCATGGTCGCCGGCTTCTGCGTGCTCTTCGCCGTCGTCTTCGCCCTGGCCATCAAGTAC
CTCAACTTCCAGAGAAGATGAGACGACGACGAGCGAGAAGCGAGCTATAGGGAGCACGAC
GTACACCACCATTAATTCTCTGGCCAGCTATAGCGCTCAAATGTGTACTGCAACTACTAT
GCATGCATCAATCCATTTCGTTTCTTCAG

CDS

4281 bp

>Os01t0177900-01 ATP-binding cassette transporter, Cuticle formation, Defense response
atgtgggcggcggaggcggcgttcgcgaggtcggggtcgtggagggaggaggaggacgag
caggaggcgctgcggtgggcggcgctgcagcggctgccgacggtggcgcgcgcgaggagg
ggCCTGCTCAGGTCGCCCGCGCCGGGGGAGGACCGGGTCCAGGGCGACGACGCGCTCTGC
GAGGTCGACGTCGCGGGCCTCTCCCCCGGCGACCGCACCGCCCTCGTCGATCGCCTCCTC
GCCGACTCCGGCGACGTTGAGGACTTCTTCCGCCGCATCCGCTCCCGCTTCGACGCAGTG
CAGATAGAGTTCCCCAAGATCGAAGTGAGGTACGAGGATCTGACAGTGGACGCATACGTG
CATGTCGGGAGCAGGGCGCTGCCAACCATCCCAAACTTCATTTGCAACATGACAGAGGCA
TTTCTGAGGCATTTGAGGATCTATCGAGGGGGAAGAGTGAAGTTGCCGATATTGGATAAT
GTTAGTGGGATCATTCGTCCATCAAGAATGACACTGCTATTGGGCCCTCCAAGTTCAGGA
AAGACAACCTTGCTTTTAGCCCTTGCCGGACGGCTTGGCCCTGGACTAAAGGTGTCTGGA
AATATCACTTACAACGGCCATCATCTGAATGAATTTGTGCCCCAGAGAACATCTGCTTAT
GTCAGTCAGCAAGACTGGCATGCCTCAGAGATGACGGTCAGAGAAACCTTAGAGTTTGCT
GGGCGCTGTCAGGGTGTTGGAATAAAGTATGATATGCTCGTTGAACTCTTGAGGAGAGAA
AAGAATGAAGGTATAAAACCCGATGAGGACCTTGATGTGTTCATGAAGGCATTGGCTCTT
GAGGGGAAGCAGACAAGCCTTGTCGCAGAATATATAATGAAGGTATATGGGCTGGACATT
TGTGCGGACACAATTGTTGGTGATGAAATGATCAAAGGAATCTCTGGGGGACAAAAGAAG
CGCCTGACAACAGGTGAGCTGTTAGTTGGTTCTGCTCGTGTGCTGTTCATGGATGAGATA
TCTACTGGACTTGACAGTGCAACCACATATCAGATTATCAAGTATTTAAGGCATTCTACT
CATGCTCTTGACGGCACTACAATCATATCCTTGTTGCAACCAGCTCCAGAAACTTACGAA
CTATTTGACGATGTCATCCTCATATCTGAAGGGCAAATTGTATATCAGGGACCACGTGAA
TATGCTGTTGATTTTTTTGCCGGTATGGGATTCAGATGTCCTGAAAGAAAAAACGTCGCT
GACTTCTTGCAAGAAGTTTTGTCCAAGAAAGACCAGCAACAATATTGGTGCCACTATGAT
TATCCTTACCAGTATGTCTCTGTATCAAAATTTGCTGAAGCCTTTAAAACATTTGTTATT
GGCAAGAGGCTGCACGATGAGTTAGCAGTTCCATACAATAGACATCGCAATCATCCCGCA
GCTCTTTCAACATCAAATTATGGTGTAAGGAGGCTTGAGCTTCTAAAGTCCAACTTTCAA
TGGCAGCATCTGCTGATGAAAAGGAATTCGTTCATCTATGTCTTCAAATTCATTCAGCTT
TTACTTGTTGCCCTCATCACAATGACAGTGTTTTTCCGATCAACAATGCACCGTGACTCA
GTTGATGATGGGATTATTTATCTTGGAGCCCTCTATTTTGCAATAGTGATGATTCTATTT
AATGGCTTTACTGAAGTCTCACTCTTGGTCACGAAGCTTCCAATTCTTTACAAGCACAGG
GATTTGCACTTCTACCCTCCATGGGCTTACACACTTCCGTCTTGGCTCTTGAGCATTCCA
ACCTCGCTTATTGAATCAGGAATGTGGGTACTAGTAACATATTATGTGGTCGGCTATGAT
CCCCAATTTACAAGATGTCTTGGACAATTTCTCTTGCTCTTTTTTCTACACCAAACATCT
TTGGCTCTTTTCCGGGTCATGGCATCTTTGGGTCGGAACATGATAGTCGCTAACACCTTT
GGATCGTTTGCTTTGTTGGTTGTTATGATCCTTGGAGGATTCATTATAACCAAAGAGAGC
ATACCAGCCTGGTGGATTTGGGGTTATTGGATATCTCCTATGATGTATGCACAAAATGCT
ATTTCCGTAAATGAATTCCTTGGCCATTCTTGGAGCCAGCAATTTGCAAACCAGAACATC
ACATTAGGGGAGGCAATACTCACTGGATATGGATTATTCAAGGAGAAATACTGGTTCTGG
ATTGGGGTTGGAGCATTGTTTGGTTATGCAATTGTTTTGAACTTCTTATTCACATTGTTC
TTGACTCTTCTCAACCCTATTGGGAATATACAAGCTGTTGTGTCCAAAGATGATATTCAG
CATAGGGCTCCTAGGAGGAAGAATGGCAAATTAGCCCTAGAGCTAAGATCTTACCTGCAC
TCAGCTTCATTGAATGGGCATAATCTCAAGGACCAGAAGGGCATGGTGTTACCATTTCAA
CCCCTTTCTATGTGCTTTAAGAACATCAACTACTACGTTGATGTACCAGCGGAATTGAAA
AGTCAAGGTATAGTAGAAGACCGCCTACAGTTGCTTATTGATGTCACTGGAGCATTTAGG
CCAGGGATACTAACAGCACTTGTTGGAGTAAGTGGAGCTGGCAAAACCACCCTCATGGAT
GTTTTAGCTGGCCGGAAAACTGGAGGACTAATAGAAGGAAGCATCACTATATCTGGGTAT
CCTAAAAACCAAGAGACTTTCACTAGGATCTCTGGTTATTGTGAACAAAATGATGTGCAT
TCACCTTGCTTGACTGTAATTGAGTCATTGCTGTACTCTGCATGCCTCCGATTGCCTTCT
CATGTTGATGTGAACACTCGAAGGGTTTTTGTTGAAGAGGTGATGGAACTTGTTGAGCTA
AATGCATTAAGTGGTGCTCTTGTTGGCCTACCAGGAGTGAATGGTCTGTCAACTGAACAA
CGCAAGAGGTTGACGATAGCTGTGGAGCTTGTGGCAAATCCTTCAATCGTGTTCATGGAT
GAACCTACATCAGGATTGGATGCTAGGTCAGCAGCTATTGTGATGAGAACCGTACGGAAT
ATTGTTAATACAGGACGGACAATTGTGTGCACCATCCATCAGCCAAGCATCGACATATTC
GAGTCATTTGATGAGCTTTTGTTCATGAAGCGTGGGGGGCAACTTATATATGCTGGTCCC
TTGGGCTCGAAATCACGCAATCTGGTCGAGTTTTTTGAGGCAATTCCAGGAGTTCCTAAA
ATCAGGGATGGCTATAATCCTGCTGCATGGATGTTGGAAGTCACAAGTACTCAAATGGAG
CAAATTCTTGGAGTGGATTTTGCTGAATACTACCGGCAGTCAAAATTATTTCAGCAGACC
CAAGAAATGGTTGATATCCTGAGCAGACCAAGAAGAGAATCAAAAGAACTTACTTTTGCC
ACCAAGTATTCCCAACCATTCTTTGCTCAATATGCTGCTTGCTTATGGAAGCAGAACCTG
TCGTACTGGAGAAATCCTCAATACACTGCGGTCCGATTCTTCTACACCGTCATCATTTCC
TTGATGTTCGGGACAATCTGCTGGAAATTTGGGTCTCGAAGGGAGACCCAACATGACATA
TTCAATGCCATGGGTGCCATGTACGCAGCAGTACTCTTCATAGGAATCACTAACGCCACC
TCTGTTCAACCTGTGATTTCCATCGAAAGATTTGTCTCGTACAGAGAGAGGGCAGCTGGG
ATGTACTCGGCACTGCCTTTTGCATTCTCCCTGGTTACAGTGGAGTTCCCTTACATTCTT
GTGCAGTCACTTATCTACGGCACGATTTTCTACAGCTTGGGCTCGTTCGAGTGGACAGCA
GTGAAGTTCTTGTGGTACCTGTTCTTCATGTACTTCACCTTGCTGTACTTCACTTTCTAT
GGCATGATGACAACGGCGATCACTCCCAACCACACTGTTGCGCCTATTATTGCTGCTCCA
TTCTACACGCTGTGGAATCTCTTCTGTGGGTTCATGATCCCAAGAAAGAGGATTCCTGCG
TGGTGGAGGTGGTATTACTGGGCCAACCCGGTGTCATGGACCCTGTACGGCCTGCTAACC
TCCCAGTTCGGCGACCTGGATCAGCCGCTGCTGCTCGCCGACGGCATCACCACCACCACC
GCCGTCGACTTCCTCCGGGACCACTTCGGCTTCCGCCACGACTTCCTCGGCGTCGTCGCC
GGCATGGTCGCCGGCTTCTGCGTGCTCTTCGCCGTCGTCTTCGCCCTGGCCATCAAGTAC
CTCAACTTCCAGAGAAGATGA

Protein

1426 aa

>Os01t0177900-01 ATP-binding cassette transporter, Cuticle formation, Defense response
MWAAEAAFARSGSWREEEDEQEALRWAALQRLPTVARARRGLLRSPAPGEDRVQGDDALC
EVDVAGLSPGDRTALVDRLLADSGDVEDFFRRIRSRFDAVQIEFPKIEVRYEDLTVDAYV
HVGSRALPTIPNFICNMTEAFLRHLRIYRGGRVKLPILDNVSGIIRPSRMTLLLGPPSSG
KTTLLLALAGRLGPGLKVSGNITYNGHHLNEFVPQRTSAYVSQQDWHASEMTVRETLEFA
GRCQGVGIKYDMLVELLRREKNEGIKPDEDLDVFMKALALEGKQTSLVAEYIMKVYGLDI
CADTIVGDEMIKGISGGQKKRLTTGELLVGSARVLFMDEISTGLDSATTYQIIKYLRHST
HALDGTTIISLLQPAPETYELFDDVILISEGQIVYQGPREYAVDFFAGMGFRCPERKNVA
DFLQEVLSKKDQQQYWCHYDYPYQYVSVSKFAEAFKTFVIGKRLHDELAVPYNRHRNHPA
ALSTSNYGVRRLELLKSNFQWQHLLMKRNSFIYVFKFIQLLLVALITMTVFFRSTMHRDS
VDDGIIYLGALYFAIVMILFNGFTEVSLLVTKLPILYKHRDLHFYPPWAYTLPSWLLSIP
TSLIESGMWVLVTYYVVGYDPQFTRCLGQFLLLFFLHQTSLALFRVMASLGRNMIVANTF
GSFALLVVMILGGFIITKESIPAWWIWGYWISPMMYAQNAISVNEFLGHSWSQQFANQNI
TLGEAILTGYGLFKEKYWFWIGVGALFGYAIVLNFLFTLFLTLLNPIGNIQAVVSKDDIQ
HRAPRRKNGKLALELRSYLHSASLNGHNLKDQKGMVLPFQPLSMCFKNINYYVDVPAELK
SQGIVEDRLQLLIDVTGAFRPGILTALVGVSGAGKTTLMDVLAGRKTGGLIEGSITISGY
PKNQETFTRISGYCEQNDVHSPCLTVIESLLYSACLRLPSHVDVNTRRVFVEEVMELVEL
NALSGALVGLPGVNGLSTEQRKRLTIAVELVANPSIVFMDEPTSGLDARSAAIVMRTVRN
IVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGQLIYAGPLGSKSRNLVEFFEAIPGVPK
IRDGYNPAAWMLEVTSTQMEQILGVDFAEYYRQSKLFQQTQEMVDILSRPRRESKELTFA
TKYSQPFFAQYAACLWKQNLSYWRNPQYTAVRFFYTVIISLMFGTICWKFGSRRETQHDI
FNAMGAMYAAVLFIGITNATSVQPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYIL
VQSLIYGTIFYSLGSFEWTAVKFLWYLFFMYFTLLYFTFYGMMTTAITPNHTVAPIIAAP
FYTLWNLFCGFMIPRKRIPAWWRWYYWANPVSWTLYGLLTSQFGDLDQPLLLADGITTTT
AVDFLRDHFGFRHDFLGVVAGMVAGFCVLFAVVFALAIKYLNFQRR*

CDS

chr01:4043136..4043431 (- strand) : 296 bp

chr01:4042474..4042594 (- strand) : 121 bp

chr01:4042178..4042266 (- strand) : 89 bp

chr01:4042008..4042092 (- strand) : 85 bp

chr01:4041525..4041684 (- strand) : 160 bp

chr01:4041367..4041443 (- strand) : 77 bp

chr01:4041220..4041280 (- strand) : 61 bp

chr01:4040453..4040536 (- strand) : 84 bp

chr01:4040020..4040321 (- strand) : 302 bp

chr01:4039655..4039936 (- strand) : 282 bp

chr01:4038636..4038952 (- strand) : 317 bp

chr01:4038383..4038543 (- strand) : 161 bp

chr01:4038176..4038279 (- strand) : 104 bp

chr01:4037778..4037934 (- strand) : 157 bp

chr01:4037570..4037689 (- strand) : 120 bp

chr01:4037391..4037485 (- strand) : 95 bp

chr01:4036971..4037303 (- strand) : 333 bp

chr01:4036591..4036881 (- strand) : 291 bp

chr01:4036168..4036251 (- strand) : 84 bp

chr01:4035922..4036055 (- strand) : 134 bp

chr01:4035616..4035843 (- strand) : 228 bp

chr01:4035362..4035533 (- strand) : 172 bp

chr01:4035007..4035261 (- strand) : 255 bp

chr01:4034077..4034349 (- strand) : 273 bp

3'UTR

chr01:4033949..4034076 (- strand) : 128 bp

FASTA

>Os01t0177900-01 class=Sequence position=chr01:4033949..4043431 (- strand)
atgtgggcgg cggaggcggc gttcgcgagg tcggggtcgt ggagggagga ggaggacgag caggaggcgc tgcggtgggc
ggcgctgcag cggctgccga cggtggcgcg cgcgaggagg ggCCTGCTCA GGTCGCCCGC GCCGGGGGAG GACCGGGTCC
AGGGCGACGA CGCGCTCTGC GAGGTCGACG TCGCGGGCCT CTCCCCCGGC GACCGCACCG CCCTCGTCGA TCGCCTCCTC
GCCGACTCCG GCGACGTTGA GGACTTCTTC CGCCGCATCC GCTCCCGCTT CGACGCGTCA GTACCACACT GCTCTCTCTC
TCTCTCCCCC TGCCTCTCTG CTCGCGTGGA AGCTTCTAGA AGCGCAACAC TCGACACTGA CATGTGGGGC CCAACTGGTA
CGCACGCACA CCGGGGGAAG CTTCTAGAAG CGCTTTGCTC GCCGCGTTCT TCTGTGGGCG AAGTACTCGG TTTCCAAAAA
CGCAGGGAAG CTTTGCGGCC GGGAGCGGCT GACACATGGG CCCCACATGC CAGTCTTGCG TTTTGTTCGC TTGCTAGTTC
AGATCCTACT CTAAAGCTAT CGTTCTGATG AAATGCCTAG ATCATGCGGG GAAGGCTACA TTTGGAACGC AGTGATTTTA
CAAAAAAATT TGCTGTAATT TTACGAAACA ATTTCAGCTA CGGCTTGTAG GATCTGTAAA TCGCTCGTCT CCTCTGGTTG
GTTTGGATTT TGGTGTAGAA TTTTGTTTGT ATGCTTGTAG TGTTGGTAAA CTTGCTCATG GGCTGATCTG AAGCATCTGT
GCTGCTCTCC ATTTTTTTTT ATTTTTGTTG GTTGCAGAGT GCAGATAGAG TTCCCCAAGA TCGAAGTGAG GTACGAGGAT
CTGACAGTGG ACGCATACGT GCATGTCGGG AGCAGGGCGC TGCCAACCAT CCCAAACTTC ATTTGCAACA TGACAGAGGT
TGGACCAATC CACCACTGGA ATTTCCCCTC CTTTGTCTCA GCTCTGCAGC AATGATCTAC TAGCTGTTTT GAACAGTAGC
ATGATTTTTA ACCACATTAG TTTTTTTTTT TACTCTGGGT AAAATTGCTG TGTAAAAAGC TGTAAATAGT GGGTTCACAA
ATGAGCTCTA GATGTGCTTA TTTGCTGTTT TTATTTTTCT GAAAGGCATT TCTGAGGCAT TTGAGGATCT ATCGAGGGGG
AAGAGTGAAG TTGCCGATAT TGGATAATGT TAGTGGGATC ATTCGTCCAT CAAGGTACAC CACGTGCAGA ACATTTTTTG
TTTCCTGCTG GATCAAATTG TACGACCTTG TAAAATTTGA CACTTGGTTC TTGCTGCAGA ATGACACTGC TATTGGGCCC
TCCAAGTTCA GGAAAGACAA CCTTGCTTTT AGCCCTTGCC GGACGGCTTG GCCCTGGACT AAAGGTGTGC CTTATCACAT
CAATCCGTCT TCTTTTCTTC GATTCTCGCC GCTCAAAGAT GATGAGCAAA TCTCTTCTAT ATGTATACAA TCAACCAACT
CTGCATCTAT CACCTGCTGA CAAGAGTACT AGTGTCTCAA ATAGCATGAA AATGGTTTTC TGGTCAAACG CTCATCCTTC
TCATTTCAGA AATACTATCG AAAAATAAAT ACTACTTCAG TGCTATAGGC CTGTGCTTAT TCTGATCAGT GCAAGAAGCC
TTTTAACCAT GCGGCATTAT TCAGGACTAT ACATTTTTAC TGACTACCAA CACCCAATGG ATTGCAGGTG TCTGGAAATA
TCACTTACAA CGGCCATCAT CTGAATGAAT TTGTGCCCCA GAGAACATCT GCTTATGTCA GTCAGCAAGA CTGGCATGCC
TCAGAGATGA CGGTCAGAGA AACCTTAGAG TTTGCTGGGC GCTGTCAGGG TGTTGGAATA AAGTATGGTA GGTCATTTCA
CCACAATGTC CTTGGTGTTG TTCCTTACCT CCTTGGTAGT TTGCGCTTTG ACGTTAATCA ATATGTAGAT ATGCTCGTTG
AACTCTTGAG GAGAGAAAAG AATGAAGGTA TAAAACCCGA TGAGGACCTT GATGTGTTCA TGAAGGTAGA TCACATCCAG
CTTTATTTGG ACACACACTA CCTGTTTTGT TGGTGATTGT CTCATGACAC TGTTTGTACT TAATTTTTCA GGCATTGGCT
CTTGAGGGGA AGCAGACAAG CCTTGTCGCA GAATATATAA TGAAGGTATA TGGTGTATCC CTTTCAGCTG CTATTATTAT
CTACTTTGGA GTCTCAAGTG TTTGCTTCTT TGAGTGAACT GCACAAATAT TTTCGAGCAA ATTTCACGAT GCATAACGAA
AACCCCCATG TTTTGGGGGC AAAATGTTTC AAGGAACCCC AGATTTTTAT AAAATATTCA TTTGCATAAT AATATATGGT
ATTTTTAGTT ATATTCACAT ATATAATGGG CACAAAATGT ACATTCTTCT TCCTCACTCT CGCTCTCCAT GATTGCACAA
ACTCAACACA AACACAGTGC TCACTGTTAA TGACAGATTA ACCAGTTACA TAAACACAAA ATGGTTTATA CTTTCGATAA
TTGACATGTG TTGGAAGTGC GGCTAATATG TATATATCAC ATACTATTTT TTACAATTAT TATGCATGGG GTTCCTTGAG
ACAAATTGCA ATACATGGGG TTTGGGTTAC GCATGTCCTA taaaacctag ggttttgtga aatttactca atatTTTCAT
CAAGCTGTTT AACCAAATGG CTCACTTAAT TCCCATCCAT TCAAGACAAT TTTCAATTTT CCCTACAATG TTATTTTGGC
TTATCATTTT TACAGCATCA ACATGATCTA CCTTTGAATC ATTTGGTTCT GGCAAGATTT CTGAATTGCT AATTTTTATC
TAGCCAAGAT TTTAGGGCTG GACATTTGTG CGGACACAAT TGTTGGTGAT GAAATGATCA AAGGAATCTC TGGGGGACAA
AAGAAGCGCC TGACAACAGG TTGTTGCATG ATAATTTAAT CTCCTTCATA TTATTGGTGC TGATGGTTGA AGAAATTGGG
CAATTGCAAG TTGTATGGAT TGCATGCTTA TTCTGGTTTG CAGCTGTGCT CATATATGTT GCTCTTGCAG GTGAGCTGTT
AGTTGGTTCT GCTCGTGTGC TGTTCATGGA TGAGATATCT ACTGGACTTG ACAGTGCAAC CACATATCAG ATTATCAAGT
ATTTAAGGCA TTCTACTCAT GCTCTTGACG GCACTACAAT CATATCCTTG TTGCAACCAG CTCCAGAAAC TTACGAACTA
TTTGACGATG TCATCCTCAT ATCTGAAGGG CAAATTGTAT ATCAGGGACC ACGTGAATAT GCTGTTGATT TTTTTGCCGG
TATGGGATTC AGATGTCCTG AAAGAAAAAA CGTCGCTGAC TTCTTGCAAG AAGTATGCAG TTGTAATCTG TGTTTGTGAT
ATTATGTTAA CTGGACTGTT CTTGCATATA GTTATTTACA TTTTCTGTGT TGCAGGTTTT GTCCAAGAAA GACCAGCAAC
AATATTGGTG CCACTATGAT TATCCTTACC AGTATGTCTC TGTATCAAAA TTTGCTGAAG CCTTTAAAAC ATTTGTTATT
GGCAAGAGGC TGCACGATGA GTTAGCAGTT CCATACAATA GACATCGCAA TCATCCCGCA GCTCTTTCAA CATCAAATTA
TGGTGTAAGG AGGCTTGAGC TTCTAAAGTC CAACTTTCAA TGGCAGCATC TGCTGATGAA AAGGAATTCG TTCATCTATG
TCTTCAAATT CATTCAGGTA TTTTCAATTT CGAGATGCAT CCAGCAGAGT AGCAGTTTGA TGTCTCAAAT AAATACTGTC
ACAAGGAAAT GTAACATTGT CTACCAGTTA AAATATAAAG CACACGTATA ATAAAGTCGC TAAACCTTGC TAAGAATAAA
AAAAACTAAG ACTGTAAATG CCCTGTTAAC TCATTTTACA ATTTCACTGC TTTAAAAGTT TAGCACACTG CAATGATCAA
TGTGCAGTTG TCACAAATGC TTGCAATTTT TCCCTACTTG GCACACGAGA GTTATCTTAG CGTGCATAAA ATGTTATAGC
CTAGTAAGTT TTCCCTACGT GGTGCGTGAA AATCATCCTA GTGTGTTTAT GTTATTGTGA CATCATGCTC AGAATCTTGG
TCACAACTCA CAAGTTTGGT CAACATGTAC TTTTACATCT TGGTGTTTTT ACTGGATTGC TGTAAACTTG ACTGGATGGC
ATATAATCCG TCAAGTCACA AAAGGATCTC GTTGTGGAGT TTCCATAGTC AAAAAGATAG ATCTTGGCTA TATCATTTTT
CACATGTCCA AAACCTTCAT TTTAAACTAT GATTGGTCAA GATTAACTTG TGTTGACTTC AAATTTCCTA ATGGCACTCT
TCTGTTTTCA GTTAAACTTC ACCTAAGTTT TATTTTCAAT CATTTGAGGG TTTTTTTTAA CATAATCTTT ATGTTGCAGC
TTTTACTTGT TGCCCTCATC ACAATGACAG TGTTTTTCCG ATCAACAATG CACCGTGACT CAGTTGATGA TGGGATTATT
TATCTTGGAG CCCTCTATTT TGCAATAGTG ATGATTCTAT TTAATGGCTT TACTGAAGTC TCACTCTTGG TCACGAAGCT
TCCAATTCTT TACAAGCACA GGGATTTGCA CTTCTACCCT CCATGGGCTT ACACACTTCC GTCTTGGCTC TTGAGCATTC
CAACCTCGCT TATTGAATCA GGAATGTGGG TACTAGTAAC ATATTATGTG GTCGGCTATG ATCCCCAATT TACAAGGTAA
TTGTTAAGTT CTGTTCATTT GCTCTCTGGT CCGATGTTCA GAGATTTTTT TCCCTATCTG AAGATTGATC TTAATTTATC
ATCTGCAGAT GTCTTGGACA ATTTCTCTTG CTCTTTTTTC TACACCAAAC ATCTTTGGCT CTTTTCCGGG TCATGGCATC
TTTGGGTCGG AACATGATAG TCGCTAACAC CTTTGGATCG TTTGCTTTGT TGGTTGTTAT GATCCTTGGA GGATTCATTA
TAACCAAAGG TTAAGCTTCT TGAGTCGACT CAGTATTAGC ACTTGAGACT TGAGAGCATC TTTCAAGATC TTACATCTGA
CATGCTGCTA CCTGTTCTTG AATATCTAAC AGAGAGCATA CCAGCCTGGT GGATTTGGGG TTATTGGATA TCTCCTATGA
TGTATGCACA AAATGCTATT TCCGTAAATG AATTCCTTGG CCATTCTTGG AGCCAGGTAA TACCTGATTT AAACCCCTTC
TTGAGGTTGG TAGCAAAGGC ACATTGTGGC AGCAATCTGT TAGCTTAGTT TGGTGTATGA AAAATACTTG CATAATATGG
AACATCGTAA TTGCTTAAAA TTATATTAAA TTTCTTTGTA TGAACCTAAC GAGATATTTT TTTATTCAGA AAAACTTTTA
TTAGCCTTAT ATAGGAATAT TTGCTTCTAT ACTAACTGTA GCTTTGAAAA ATGGCAGCAA TTTGCAAACC AGAACATCAC
ATTAGGGGAG GCAATACTCA CTGGATATGG ATTATTCAAG GAGAAATACT GGTTCTGGAT TGGGGTTGGA GCATTGTTTG
GTTATGCAAT TGTTTTGAAC TTCTTATTCA CATTGTTCTT GACTCTTCTC AACCGTAAGT TTGTGCTAAC TTCATGGACC
CAGACAACTT AGAACTGCAA TCAAAATAGT TTCTCATTCT CACAACTGGT GCTCCTTCAC AGCTATTGGG AATATACAAG
CTGTTGTGTC CAAAGATGAT ATTCAGCATA GGGCTCCTAG GAGGAAGAAT GGCAAATTAG CCCTAGAGCT AAGATCTTAC
CTGCACTCAG CTTCATTGAA TGGTAATGCT AGATAATGAA TCCCTGTACT TACATCACAA TTCATTTTTA CCCTTTTACT
AAGTCTTCAT ATTAACTGTG TTCCAGGGCA TAATCTCAAG GACCAGAAGG GCATGGTGTT ACCATTTCAA CCCCTTTCTA
TGTGCTTTAA GAACATCAAC TACTACGTTG ATGTACCAGC GGTATGTCAG GGGGAGGCCG GTTTATATGG CTGAAATTTC
TTTTAAAAAT CTATGTATAT TGATTCATAA TCAAGTTTTG CCTAGCAGGA ATTGAAAAGT CAAGGTATAG TAGAAGACCG
CCTACAGTTG CTTATTGATG TCACTGGAGC ATTTAGGCCA GGGATACTAA CAGCACTTGT TGGAGTAAGT GGAGCTGGCA
AAACCACCCT CATGGATGTT TTAGCTGGCC GGAAAACTGG AGGACTAATA GAAGGAAGCA TCACTATATC TGGGTATCCT
AAAAACCAAG AGACTTTCAC TAGGATCTCT GGTTATTGTG AACAAAATGA TGTGCATTCA CCTTGCTTGA CTGTAATTGA
GTCATTGCTG TACTCTGCAT GCCTCCGATT GCCTTCTCAT GTTGATGTGA ACACTCGAAG GGTAAAGTCT TGGCTGGGCT
GCAGTGCTAT GTTTATTGTA CAAGACATCA CTATTTTTGT CATTCTGATC CCTGATGGTT CATTTCATAG GTTTTTGTTG
AAGAGGTGAT GGAACTTGTT GAGCTAAATG CATTAAGTGG TGCTCTTGTT GGCCTACCAG GAGTGAATGG TCTGTCAACT
GAACAACGCA AGAGGTTGAC GATAGCTGTG GAGCTTGTGG CAAATCCTTC AATCGTGTTC ATGGATGAAC CTACATCAGG
ATTGGATGCT AGGTCAGCAG CTATTGTGAT GAGAACCGTA CGGAATATTG TTAATACAGG ACGGACAATT GTGTGCACCA
TCCATCAGCC AAGCATCGAC ATATTCGAGT CATTTGATGA GGTTAATTTC TTTACAAAAC CTAGTAGTCA ATTTATGCAT
GCATGACAAG CAATAGTTCA AAAGTCATTA TTTTGAGCTA TCCTTTTCGT GACATATTAA CAAGTTGAGC ACAGATTTTG
ATATTTTTTC GAAGCAACAG TACAGATTTT AATAATCGTT CATAATTTGA TGTTAATCAG TTTTCTTATC AATGATGGAT
GTGAACAGAA ACTAGTCCCT TTTACACTTG ATCTGTTGAA CTTTCATTGT GCTACTTAGG GAAACCGCGA AATTTTCTTA
TACAAGTATG TACTAACATT TAACCAGCAC CCTTTCCTAA CTCATTCATA TGCTGGTCAG CTTTTGTTCA TGAAGCGTGG
GGGGCAACTT ATATATGCTG GTCCCTTGGG CTCGAAATCA CGCAATCTGG TCGAGTTTTT TGAGGTACAA TCTGCACAAT
GTGTTTCCTC AGTGATGATA GCTTATACAA GTTTCTCTGT CCTTACACTT TGCGTTCGCG AAAAAACTGT CCTTACACTT
TCAAGTTTGT AAACAGGCAA TTCCAGGAGT TCCTAAAATC AGGGATGGCT ATAATCCTGC TGCATGGATG TTGGAAGTCA
CAAGTACTCA AATGGAGCAA ATTCTTGGAG TGGATTTTGC TGAATACTAC CGGCAGTCAA AATTATTTCA GTAAACACAA
CGACCCTTTT CACCTCTATA AATCTTGGTC TCTTTTTCCT TAAACATGTT TATGTTATGG CATTCCAGGC AGACCCAAGA
AATGGTTGAT ATCCTGAGCA GACCAAGAAG AGAATCAAAA GAACTTACTT TTGCCACCAA GTATTCCCAA CCATTCTTTG
CTCAATATGC TGCTTGCTTA TGGAAGCAGA ACCTGTCGTA CTGGAGAAAT CCTCAATACA CTGCGGTCCG ATTCTTCTAC
ACCGTCATCA TTTCCTTGAT GTTCGGGACA ATCTGCTGGA AATTTGGGTC TCGAAGGTAT GTCCACTGAT GATTCTGTCT
CCACTTTTCT TCCTGTACTT GGCTGGCCTT ATAGCGAACA TGTGGCTTTG TTTGACAGGG AGACCCAACA TGACATATTC
AATGCCATGG GTGCCATGTA CGCAGCAGTA CTCTTCATAG GAATCACTAA CGCCACCTCT GTTCAACCTG TGATTTCCAT
CGAAAGATTT GTCTCGTACA GAGAGAGGGC AGCTGGGATG TACTCGGCAC TGCCTTTTGC ATTCTCCCTG GTAATTTTCC
CTGTCAAAAA CTCCTGTCAT CTCATCATGT TTTGATGCTC GTAGTAGTAC CATAATAAGG CTAACAATCG AACTGTTCTT
CGGCATGCAG GTTACAGTGG AGTTCCCTTA CATTCTTGTG CAGTCACTTA TCTACGGCAC GATTTTCTAC AGCTTGGGCT
CGTTCGAGTG GACAGCAGTG AAGTTCTTGT GGTACCTGTT CTTCATGTAC TTCACCTTGC TGTACTTCAC TTTCTATGGC
ATGATGACAA CGGCGATCAC TCCCAACCAC ACTGTTGCGC CTATTATTGC TGCTCCATTC TACACGCTGT GGAATCTCTT
CTGTGGGTTC ATGATCCCAA GAAAGGTACG GAAGGAACAG GAACCCCATG CATAATTTGC ACCTAACGTC CTCTAATTGT
ACTGGACCCA TGATCTGTTT TCCCCATAAT CCATATTCCA GTGCACATTA TCCATATCTT TATTTTTTTT GTCACATTAG
CATATATAGC TATGGAAATA GTGTTTCCAA TCCATAAGGC CACTTCCAGT GCACATTATC CATATCTTTA TTTTTTTTTG
TCACATTAAC ATATATAGCT ATGGAAATAG TGTTTCCAAT GCATATTATT TATTACTGGG GCCAAAAATG AATTATCTCC
CTTCGCAAAT TTCATCAGAA ATTCTTAGAG GAGATATCTA TTTTCCTGGT TTGAATATAT ATGCAATGTC TCATCCGAGA
CACTCTTTTT TCTTTATAAT TCCTTAGCAC ATCATCTAAA ATGCTGCTAT GTTGCATAGT AGTTTTTAGT TTCTATTAAC
ATTGTACTAT AATGGAGCAT GAGTGCCCTG ATATACCAGT GCCCCTAATA ATTTCACCAA ACCCACCAGT AACTTTTTTT
GTCCTACAGT GACCACTTGT CATGTACTAG AACCACTTTA GCAATTGGGA AGCAATAATG GTTTGTTTAA ATTAGGACGT
GATTAAAGTG GCTAATGATT AATGGGCTTA AACATAATGC AGAGGATTCC TGCGTGGTGG AGGTGGTATT ACTGGGCCAA
CCCGGTGTCA TGGACCCTGT ACGGCCTGCT AACCTCCCAG TTCGGCGACC TGGATCAGCC GCTGCTGCTC GCCGACGGCA
TCACCACCAC CACCGCCGTC GACTTCCTCC GGGACCACTT CGGCTTCCGC CACGACTTCC TCGGCGTCGT CGCCGGCATG
GTCGCCGGCT TCTGCGTGCT CTTCGCCGTC GTCTTCGCCC TGGCCATCAA GTACCTCAAC TTCCAGAGAA GATGAGACGA
CGACGAGCGA GAAGCGAGCT ATAGGGAGCA CGACGTACAC CACCATTAAT TCTCTGGCCA GCTATAGCGC TCAAATGTGT
ACTGCAACTA CTATGCATGC ATCAATCCAT TTCGTTTCTT CAG

Locus: Os01g0177900

Loading...

Locus: Os01g0177900

Loading...