Os01t0177900-02

Locus

Os01g0177900

Description

Similar to Pleiotropic drug resistance protein 6.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR6

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 6

Oryzabase Gene Symbol Synonym(s)

OsPDR6, OsABCG31, OsABCG31_1

Oryzabase Gene Name Synonym(s)

sativa pleiotropic drug resistance 6, Pleiotropic drug resistance protein 6, ABC transporter superfamily ABCG subgroup member 31, ATP-binding Cassette Transporter G31

Transcript Evidence

AK058355 (DDBJ, Best hit)

Protein Evidence

B9ETF6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

ABC-2 type transporter (IPR013525)

Full-length cDNA

001-014-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0177900-02)

RiceXPro (AK058355)

Others

Oryzabase (8339)

KEGG (Os01t0177900-02)

Transcript

1519 bp

>Os01t0177900-02 Similar to Pleiotropic drug resistance protein 6.
TTATATATGCTGGTCCCTTGGGCTCGAAATCACGCAATCTGGTCGAGTTTTTTGAGGCAA
TTCCAGGAGTTCCTAAAATCAGGGATGGCTATAATCCTGCTGCATGGATGTTGGAAGTCA
CAAGTACTCAAATGGAGCAAATTCTTGGAGTGGATTTTGCTGAATACTACCGGCAGTCAA
AATTATTTCAGTAAACACAACGACCCTTTTCACCTCTATAAATCTTGGTCTCTTTTTCCT
TAAACATGTTTATGTTATGGCATTCCAGGCAGACCCAAGAAATGGTTGATATCCTGAGCA
GACCAAGAAGAGAATCAAAAGAACTTACTTTTGCCACCAAGTATTCCCAACCATTCTTTG
CTCAATATGCTGCTTGCTTATGGAAGCAGAACCTGTCGTACTGGAGAAATCCTCAATACA
CTGCGGTCCGATTCTTCTACACCGTCATCATTTCCTTGATGTTCGGGACAATCTGCTGGA
AATTTGGGTCTCGAAGGGAGACCCAACATGACATATTCAATGCCATGGGTGCCATGTACG
CAGCAGTACTCTTCATAGGAATCACTAACGCCACCTCTGTTCAACCTGTGATTTCCATCG
AAAGATTTGTCTCGTACAGAGAGAGGGCAGCTGGGATGTACTCGGCACTGCCTTTTGCAT
TCTCCCTGGTTACAGTGGAGTTCCCTTACATTCTTGTGCAGTCACTTATCTACGGCACGA
TTTTCTACAGCTTGGGCTCGTTCGAGTGGACAGCAGTGAAGTTCTTGTGGTACCTGTTCT
TCATGTACTTCACCTTGCTGTACTTCACTTTCTATGGCATGATGACAACGGCGATCACTC
CCAACCACACTGTTGCGCCTATTATTGCTGCTCCATTCTACACGCTGTGGAATCTCTTCT
GTGGGTTCATGATCCCAAGAAAGAGGATTCCTGCGTGGTGGAGGTGGTATTACTGGGCCA
ACCCGGTGTCATGGACCCTGTACGGCCTGCTAACCTCCCAGTTCGGCGACCTGGATCAGC
CGCTGCTGCTCGCCGACGGCATCACCACCACCACCGCCGTCGACTTCCTCCGGGACCACT
TCGGCTTCCGCCACGACTTCCTCGGCGTCGTCGCCGGCATGGTCGCCGGCTTCTGCGTGC
TCTTCGCCGTCGTCTTCGCCCTGGCCATCAAGTACCTCAACTTCCAGAGAAGATGAGACG
ACGACGAGCGAGAAGCGAGCTATAGGGAGCACGACGTACACCACCATTAATTCTCTGGCC
AGCTATAGCGCTCAAATGTGTACTGCAACTACTATGCATGCATCAATCCATTTCGTTTCT
TCAGAACTGCACGCGTCTCTTCTCTCTGTCGTCACGATGAATTCCTCCCGGTCACGGGAG
ATGCTGGAGCTAGCAGAGATCAGAGACCAGCAGAAAAAAGGAGACAAGTGTATAGCTAAG
CTACCTGTTGCAAgcctgtttggcagatctccaacaactagatctaactcggagctaaag
tgaagctgtggaacagccg

CDS

975 bp

>Os01t0177900-02 Similar to Pleiotropic drug resistance protein 6.
ATCTTGGTCTCTTTTTCCTTAAACATGTTTATGTTATGGCATTCCAGGCAGACCCAAGAA
ATGGTTGATATCCTGAGCAGACCAAGAAGAGAATCAAAAGAACTTACTTTTGCCACCAAG
TATTCCCAACCATTCTTTGCTCAATATGCTGCTTGCTTATGGAAGCAGAACCTGTCGTAC
TGGAGAAATCCTCAATACACTGCGGTCCGATTCTTCTACACCGTCATCATTTCCTTGATG
TTCGGGACAATCTGCTGGAAATTTGGGTCTCGAAGGGAGACCCAACATGACATATTCAAT
GCCATGGGTGCCATGTACGCAGCAGTACTCTTCATAGGAATCACTAACGCCACCTCTGTT
CAACCTGTGATTTCCATCGAAAGATTTGTCTCGTACAGAGAGAGGGCAGCTGGGATGTAC
TCGGCACTGCCTTTTGCATTCTCCCTGGTTACAGTGGAGTTCCCTTACATTCTTGTGCAG
TCACTTATCTACGGCACGATTTTCTACAGCTTGGGCTCGTTCGAGTGGACAGCAGTGAAG
TTCTTGTGGTACCTGTTCTTCATGTACTTCACCTTGCTGTACTTCACTTTCTATGGCATG
ATGACAACGGCGATCACTCCCAACCACACTGTTGCGCCTATTATTGCTGCTCCATTCTAC
ACGCTGTGGAATCTCTTCTGTGGGTTCATGATCCCAAGAAAGAGGATTCCTGCGTGGTGG
AGGTGGTATTACTGGGCCAACCCGGTGTCATGGACCCTGTACGGCCTGCTAACCTCCCAG
TTCGGCGACCTGGATCAGCCGCTGCTGCTCGCCGACGGCATCACCACCACCACCGCCGTC
GACTTCCTCCGGGACCACTTCGGCTTCCGCCACGACTTCCTCGGCGTCGTCGCCGGCATG
GTCGCCGGCTTCTGCGTGCTCTTCGCCGTCGTCTTCGCCCTGGCCATCAAGTACCTCAAC
TTCCAGAGAAGATGA

Protein

324 aa

>Os01t0177900-02 Similar to Pleiotropic drug resistance protein 6.
ILVSFSLNMFMLWHSRQTQEMVDILSRPRRESKELTFATKYSQPFFAQYAACLWKQNLSY
WRNPQYTAVRFFYTVIISLMFGTICWKFGSRRETQHDIFNAMGAMYAAVLFIGITNATSV
QPVISIERFVSYRERAAGMYSALPFAFSLVTVEFPYILVQSLIYGTIFYSLGSFEWTAVK
FLWYLFFMYFTLLYFTFYGMMTTAITPNHTVAPIIAAPFYTLWNLFCGFMIPRKRIPAWW
RWYYWANPVSWTLYGLLTSQFGDLDQPLLLADGITTTTAVDFLRDHFGFRHDFLGVVAGM
VAGFCVLFAVVFALAIKYLNFQRR*

5'UTR

chr01:4036168..4036223 (- strand) : 56 bp

chr01:4035891..4036055 (- strand) : 165 bp

CDS

chr01:4035616..4035890 (- strand) : 275 bp

chr01:4035362..4035533 (- strand) : 172 bp

chr01:4035007..4035261 (- strand) : 255 bp

chr01:4034077..4034349 (- strand) : 273 bp

3'UTR

chr01:4033754..4034076 (- strand) : 323 bp

FASTA

>Os01t0177900-02 class=Sequence position=chr01:4033754..4036223 (- strand)
TTATATATGC TGGTCCCTTG GGCTCGAAAT CACGCAATCT GGTCGAGTTT TTTGAGGTAC AATCTGCACA ATGTGTTTCC
TCAGTGATGA TAGCTTATAC AAGTTTCTCT GTCCTTACAC TTTGCGTTCG CGAAAAAACT GTCCTTACAC TTTCAAGTTT
GTAAACAGGC AATTCCAGGA GTTCCTAAAA TCAGGGATGG CTATAATCCT GCTGCATGGA TGTTGGAAGT CACAAGTACT
CAAATGGAGC AAATTCTTGG AGTGGATTTT GCTGAATACT ACCGGCAGTC AAAATTATTT CAGTAAACAC AACGACCCTT
TTCACCTCTA TAAATCTTGG TCTCTTTTTC CTTAAACATG TTTATGTTAT GGCATTCCAG GCAGACCCAA GAAATGGTTG
ATATCCTGAG CAGACCAAGA AGAGAATCAA AAGAACTTAC TTTTGCCACC AAGTATTCCC AACCATTCTT TGCTCAATAT
GCTGCTTGCT TATGGAAGCA GAACCTGTCG TACTGGAGAA ATCCTCAATA CACTGCGGTC CGATTCTTCT ACACCGTCAT
CATTTCCTTG ATGTTCGGGA CAATCTGCTG GAAATTTGGG TCTCGAAGGT ATGTCCACTG ATGATTCTGT CTCCACTTTT
CTTCCTGTAC TTGGCTGGCC TTATAGCGAA CATGTGGCTT TGTTTGACAG GGAGACCCAA CATGACATAT TCAATGCCAT
GGGTGCCATG TACGCAGCAG TACTCTTCAT AGGAATCACT AACGCCACCT CTGTTCAACC TGTGATTTCC ATCGAAAGAT
TTGTCTCGTA CAGAGAGAGG GCAGCTGGGA TGTACTCGGC ACTGCCTTTT GCATTCTCCC TGGTAATTTT CCCTGTCAAA
AACTCCTGTC ATCTCATCAT GTTTTGATGC TCGTAGTAGT ACCATAATAA GGCTAACAAT CGAACTGTTC TTCGGCATGC
AGGTTACAGT GGAGTTCCCT TACATTCTTG TGCAGTCACT TATCTACGGC ACGATTTTCT ACAGCTTGGG CTCGTTCGAG
TGGACAGCAG TGAAGTTCTT GTGGTACCTG TTCTTCATGT ACTTCACCTT GCTGTACTTC ACTTTCTATG GCATGATGAC
AACGGCGATC ACTCCCAACC ACACTGTTGC GCCTATTATT GCTGCTCCAT TCTACACGCT GTGGAATCTC TTCTGTGGGT
TCATGATCCC AAGAAAGGTA CGGAAGGAAC AGGAACCCCA TGCATAATTT GCACCTAACG TCCTCTAATT GTACTGGACC
CATGATCTGT TTTCCCCATA ATCCATATTC CAGTGCACAT TATCCATATC TTTATTTTTT TTGTCACATT AGCATATATA
GCTATGGAAA TAGTGTTTCC AATCCATAAG GCCACTTCCA GTGCACATTA TCCATATCTT TATTTTTTTT TGTCACATTA
ACATATATAG CTATGGAAAT AGTGTTTCCA ATGCATATTA TTTATTACTG GGGCCAAAAA TGAATTATCT CCCTTCGCAA
ATTTCATCAG AAATTCTTAG AGGAGATATC TATTTTCCTG GTTTGAATAT ATATGCAATG TCTCATCCGA GACACTCTTT
TTTCTTTATA ATTCCTTAGC ACATCATCTA AAATGCTGCT ATGTTGCATA GTAGTTTTTA GTTTCTATTA ACATTGTACT
ATAATGGAGC ATGAGTGCCC TGATATACCA GTGCCCCTAA TAATTTCACC AAACCCACCA GTAACTTTTT TTGTCCTACA
GTGACCACTT GTCATGTACT AGAACCACTT TAGCAATTGG GAAGCAATAA TGGTTTGTTT AAATTAGGAC GTGATTAAAG
TGGCTAATGA TTAATGGGCT TAAACATAAT GCAGAGGATT CCTGCGTGGT GGAGGTGGTA TTACTGGGCC AACCCGGTGT
CATGGACCCT GTACGGCCTG CTAACCTCCC AGTTCGGCGA CCTGGATCAG CCGCTGCTGC TCGCCGACGG CATCACCACC
ACCACCGCCG TCGACTTCCT CCGGGACCAC TTCGGCTTCC GCCACGACTT CCTCGGCGTC GTCGCCGGCA TGGTCGCCGG
CTTCTGCGTG CTCTTCGCCG TCGTCTTCGC CCTGGCCATC AAGTACCTCA ACTTCCAGAG AAGATGAGAC GACGACGAGC
GAGAAGCGAG CTATAGGGAG CACGACGTAC ACCACCATTA ATTCTCTGGC CAGCTATAGC GCTCAAATGT GTACTGCAAC
TACTATGCAT GCATCAATCC ATTTCGTTTC TTCAGAACTG CACGCGTCTC TTCTCTCTGT CGTCACGATG AATTCCTCCC
GGTCACGGGA GATGCTGGAG CTAGCAGAGA TCAGAGACCA GCAGAAAAAA GGAGACAAGT GTATAGCTAA GCTACCTGTT
GCAAgcctgt ttggcagatc tccaacaact agatctaact cggagctaaa gtgaagctgt ggaacagccg 

Locus: Os01g0177900

Loading...

Locus: Os01g0177900

Loading...