Os01t0178300-01

Locus

Os01g0178300

Description

Plasma membrane-localized small peptide, Aluminum tolerance

RAP-DB Gene Symbol Synonym(s)

CDT3, OsCDT3

RAP-DB Gene Name Synonym(s)

CADMIUM TOLERANT 3, sativa DcCDT1 homologue 3, cadmium tolerance 3

CGSNL Gene Symbol

CDT3

CGSNL Gene Name

CADMIUM TOLERANT 3

Oryzabase Gene Symbol Synonym(s)

OsCDT3

Oryzabase Gene Name Synonym(s)

sativa DcCDT1 homologue 3, cadmium tolerance 3

Transcript Evidence

AB787528

Protein Evidence

Q5VRD7

Literature

PMID: 23888867

Note

Manual Curation

November 25, 2013

Functional domain (InterPro)

Cysteine-rich transmembrane CYSTM domain (IPR028144)

Expression Databases

TENOR (Os01t0178300-01)

Others

Oryzabase (8300)

Transcript

539 bp

>Os01t0178300-01 Plasma membrane-localized small peptide, Aluminum tolerance
ATGCTCTGTTAGTGCCTTCTGTCTATCTATCCCCCTTGCTGGTTTCTTCCTCCTCTTCTG
CGTCGTCGACTTCGTCTCCGGCGGCCGCGGCACGGGCGGCGATGTACAACCCTCCGGCGG
CGCAGGAGATGTCCTACTCCGACCATGTCAAGAAGCGCCATGAGGACAAAGGCTGCCTCT
ATGCATGCCTGTTCACCCTCTGCTGCTGCTTCTGCTGCTACGAGACCTGCGAGTGCTGCC
TCGAATGCCTCTGCTGCTGCTGATCTCCTTATCTCATTTCAGCAGTCAAAATAATGATGA
TGATATATCATATATAGTCAGGAATAAAAGATATAATATGCCGTTTGAAATGCAGGAATT
TATTTTTCCGATTTCAAACCATAGTTTGTTGTTGTATGTGTACTGGTGACAATATCATGG
TAGATGAAACTTTCTGAAAATTTGGTAGGTATCAGCAAGATTTGATCTTTTTAGTTGTGC
TCCCATCTATAAAATGAATAAATATATTTAAGCTGCCTGCCGAGATAAAATTATTAATC

CDS

162 bp

>Os01t0178300-01 Plasma membrane-localized small peptide, Aluminum tolerance
ATGTACAACCCTCCGGCGGCGCAGGAGATGTCCTACTCCGACCATGTCAAGAAGCGCCAT
GAGGACAAAGGCTGCCTCTATGCATGCCTGTTCACCCTCTGCTGCTGCTTCTGCTGCTAC
GAGACCTGCGAGTGCTGCCTCGAATGCCTCTGCTGCTGCTGA

Protein

54 aa

>Os01t0178300-01 Plasma membrane-localized small peptide, Aluminum tolerance
MYNPPAAQEMSYSDHVKKRHEDKGCLYACLFTLCCCFCCYETCECCLECLCCC*

5'UTR

chr01:4067219..4067319 (- strand) : 101 bp

CDS

chr01:4067133..4067218 (- strand) : 86 bp

chr01:4066623..4066698 (- strand) : 76 bp

3'UTR

chr01:4066347..4066622 (- strand) : 276 bp

FASTA

>Os01t0178300-01 class=Sequence position=chr01:4066347..4067319 (- strand)
ATGCTCTGTT AGTGCCTTCT GTCTATCTAT CCCCCTTGCT GGTTTCTTCC TCCTCTTCTG CGTCGTCGAC TTCGTCTCCG
GCGGCCGCGG CACGGGCGGC GATGTACAAC CCTCCGGCGG CGCAGGAGAT GTCCTACTCC GACCATGTCA AGAAGCGCCA
TGAGGACAAA GGCTGCCTCT ATGCATGGTG ATCCTCTTCT TCTGTCATGC TCTTCTAATC TTTCAGAGAA GCTGTTGATG
CTATTTTATG TTGCTTATTA ATTTGGATGT CATCTAAACT AGGTTATATT CTCTAGATTA GGATGTGATC TAAGGTATTT
TTCAAAGTAG AAATTAGGAC ATGTTTGTTC ATCTTGGATG CACTGTTCAA CATTTCTCAA ATCATCAGAT AGTTCATCTA
GTTTCTTCAG ACAAGCTGAT TTCTGCATCA TGTGAGCATT GAACACACTC CTAAAGTCCT ACTAGATTCA GAGATGGATG
AGCTGAAGTA GTTAGTGGTC ATTTTCATGT CCAAGAAAAC CAAAGATCAT GTGAGATTTT GCCCTGATCA AGAGGGCTTC
TTCACCATTT GACACCTTTT TTCCTCTGTT TACCTGTGAT CTCTTTCCCT TTTTGTTGCA GCCTGTTCAC CCTCTGCTGC
TGCTTCTGCT GCTACGAGAC CTGCGAGTGC TGCCTCGAAT GCCTCTGCTG CTGCTGATCT CCTTATCTCA TTTCAGCAGT
CAAAATAATG ATGATGATAT ATCATATATA GTCAGGAATA AAAGATATAA TATGCCGTTT GAAATGCAGG AATTTATTTT
TCCGATTTCA AACCATAGTT TGTTGTTGTA TGTGTACTGG TGACAATATC ATGGTAGATG AAACTTTCTG AAAATTTGGT
AGGTATCAGC AAGATTTGAT CTTTTTAGTT GTGCTCCCAT CTATAAAATG AATAAATATA TTTAAGCTGC CTGCCGAGAT
AAAATTATTA ATC