Os01t0178600-01

Locus

Os01g0178600

Description

Aspartate protease, Disease resistance

RAP-DB Gene Symbol Synonym(s)

OsCDR1

RAP-DB Gene Name Synonym(s)

constitutive disease resistance 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCDR1

Oryzabase Gene Name Synonym(s)

CONSTITUTIVE DISEASE RESISTANCE 1

Transcript Evidence

Inferred from literature

Protein Evidence

Q5VRD5

Literature

PMID: 20347986

PMID: 19888828

Note

Manual Curation

October 5, 2020

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: aspartic-type endopeptidase activity (GO:0004190)

Functional domain (InterPro)

Aspartic peptidase domain superfamily (IPR021109)

Aspartic peptidase A1 family (IPR001461)

Xylanase inhibitor, N-terminal (IPR032861)

Peptidase family A1 domain (IPR033121)

Pepsin-like domain, plant (IPR034161)

Xylanase inhibitor, C-terminal (IPR032799)

Expression Databases

TENOR (Os01t0178600-00)

Others

Oryzabase (13345)

Transcript

1365 bp

>Os01t0178600-01 Aspartate protease, Disease resistance
atggcggccatggcgccttcctccgtgctcgtgctcctcggcgtcgtcctccTCGTCGCC
GGCGGGAGGCTGTGCGAGTGCGCGGCGAGCGGCGGCGGATTCAGCGTGGAGTTCATCCAC
CGTGACTCACCCAGGTCGCCGTTCCATGACCCGGCGTTCACCGCCCACGGCCGCGCGCTC
GCGGCGGCGCGGCGGTCCGTGGCGCGCGCCGCCGCGATCGCGGGCTCCGCCTCCTCCTCC
GCCTCCGGCGGCGGCGCGGCGGACGACGTCGTGTCGAAGGTCGTGTCCCGGTCGTTCGAG
TACCTCATGACGGTCAACCTCGGCTCGCCGCCGCGCTCGATGCTGGCCATCGCCGACACG
GGCAGCGACCTCGTGTGGGTGAAGTGCAAGAAGGGGAACAACGACACCTCATCGGCGGCG
GCGCCGACGACGCAGTTCGACCCGTCCCGGTCGTCGACGTACGGCCGCGTGAGCTGCCAA
ACCGACGCCTGCGAGGCGCTCGGCCGCGCCACCTGCGACGACGGGTCGAACTGCGCCTAC
CTCTACGCCTACGGCGACGGGTCGAACACCACCGGCGTCCTCTCCACCGAAACCTTCACC
TTCGACGACGGCGGCTCGGGGAGGagcccccgccaggtgcgcgtcggcggcgtcaagttc
ggctgctccaccgcgacggccggctcgttcccggccgacggtctggtcggcctcggcggc
ggcgcggtctccctcgtgacgcagctcggcggcgcgacgtcgctcgggcggagattctcc
tactgcctcgtcccgcactccgtcaacgcctcgtcggcgctcaacttcggcgccctcgcc
gacgtcaccgagcccggcgcggcgagcacgccgctcgtcgccggcgacgtggacacgtac
tacaccgtggtcctcgactccgtcaaggtcgggaacaagacggtggcgtcggcggcgagc
tcccgcatcatcgtggactccggcacgacgctgacgttcctcgacccgtcgctgctgGGG
CCGATCGTCGACGAGCTCTCCCGCCGGATCACGCTGCCGCCGGTGCAGTCGCCGGACGGG
CTGCTGCAGCTGTGCTACAACGTTGCCGGGCGGGAGGTGGAGGCCGGCGAGAGCATCCCG
GACTTGACGCTGGAGTTCGGCGGCGGCGCGGCGGTGGCGCTGAAGCCGGAGAACGCGTTC
GTGGCGGTGCAGGAGGGGACGCTGTGCCTGGCAATCGTGGCGACGACGGAGCAGCAGCCG
GTGTCCATCCTCGGGAACCTCGCGCAGCAGAACATCCACGTCGGCTACGACCTCGACGCC
GGCACGGTCACCTTCGCCGGCGCCGACTGCGCCGGCTCATCCTAG

CDS

1365 bp

>Os01t0178600-01 Aspartate protease, Disease resistance
atggcggccatggcgccttcctccgtgctcgtgctcctcggcgtcgtcctccTCGTCGCC
GGCGGGAGGCTGTGCGAGTGCGCGGCGAGCGGCGGCGGATTCAGCGTGGAGTTCATCCAC
CGTGACTCACCCAGGTCGCCGTTCCATGACCCGGCGTTCACCGCCCACGGCCGCGCGCTC
GCGGCGGCGCGGCGGTCCGTGGCGCGCGCCGCCGCGATCGCGGGCTCCGCCTCCTCCTCC
GCCTCCGGCGGCGGCGCGGCGGACGACGTCGTGTCGAAGGTCGTGTCCCGGTCGTTCGAG
TACCTCATGACGGTCAACCTCGGCTCGCCGCCGCGCTCGATGCTGGCCATCGCCGACACG
GGCAGCGACCTCGTGTGGGTGAAGTGCAAGAAGGGGAACAACGACACCTCATCGGCGGCG
GCGCCGACGACGCAGTTCGACCCGTCCCGGTCGTCGACGTACGGCCGCGTGAGCTGCCAA
ACCGACGCCTGCGAGGCGCTCGGCCGCGCCACCTGCGACGACGGGTCGAACTGCGCCTAC
CTCTACGCCTACGGCGACGGGTCGAACACCACCGGCGTCCTCTCCACCGAAACCTTCACC
TTCGACGACGGCGGCTCGGGGAGGagcccccgccaggtgcgcgtcggcggcgtcaagttc
ggctgctccaccgcgacggccggctcgttcccggccgacggtctggtcggcctcggcggc
ggcgcggtctccctcgtgacgcagctcggcggcgcgacgtcgctcgggcggagattctcc
tactgcctcgtcccgcactccgtcaacgcctcgtcggcgctcaacttcggcgccctcgcc
gacgtcaccgagcccggcgcggcgagcacgccgctcgtcgccggcgacgtggacacgtac
tacaccgtggtcctcgactccgtcaaggtcgggaacaagacggtggcgtcggcggcgagc
tcccgcatcatcgtggactccggcacgacgctgacgttcctcgacccgtcgctgctgGGG
CCGATCGTCGACGAGCTCTCCCGCCGGATCACGCTGCCGCCGGTGCAGTCGCCGGACGGG
CTGCTGCAGCTGTGCTACAACGTTGCCGGGCGGGAGGTGGAGGCCGGCGAGAGCATCCCG
GACTTGACGCTGGAGTTCGGCGGCGGCGCGGCGGTGGCGCTGAAGCCGGAGAACGCGTTC
GTGGCGGTGCAGGAGGGGACGCTGTGCCTGGCAATCGTGGCGACGACGGAGCAGCAGCCG
GTGTCCATCCTCGGGAACCTCGCGCAGCAGAACATCCACGTCGGCTACGACCTCGACGCC
GGCACGGTCACCTTCGCCGGCGCCGACTGCGCCGGCTCATCCTAG

Protein

455 aa

>Os01t0178600-01 Aspartate protease, Disease resistance
MAAMAPSSVLVLLGVVLLVAGGRLCECAASGGGFSVEFIHRDSPRSPFHDPAFTAHGRAL
AAARRSVARAAAIAGSASSSASGGGAADDVVSKVVSRSFEYLMTVNLGSPPRSMLAIADT
GSDLVWVKCKKGNNDTSSAAAPTTQFDPSRSSTYGRVSCQTDACEALGRATCDDGSNCAY
LYAYGDGSNTTGVLSTETFTFDDGGSGRSPRQVRVGGVKFGCSTATAGSFPADGLVGLGG
GAVSLVTQLGGATSLGRRFSYCLVPHSVNASSALNFGALADVTEPGAASTPLVAGDVDTY
YTVVLDSVKVGNKTVASAASSRIIVDSGTTLTFLDPSLLGPIVDELSRRITLPPVQSPDG
LLQLCYNVAGREVEAGESIPDLTLEFGGGAAVALKPENAFVAVQEGTLCLAIVATTEQQP
VSILGNLAQQNIHVGYDLDAGTVTFAGADCAGSS*

CDS

chr01:4081316..4082680 (+ strand) : 1365 bp

FASTA

>Os01t0178600-01 class=Sequence position=chr01:4081316..4082680 (+ strand)
atggcggcca tggcgccttc ctccgtgctc gtgctcctcg gcgtcgtcct ccTCGTCGCC GGCGGGAGGC TGTGCGAGTG
CGCGGCGAGC GGCGGCGGAT TCAGCGTGGA GTTCATCCAC CGTGACTCAC CCAGGTCGCC GTTCCATGAC CCGGCGTTCA
CCGCCCACGG CCGCGCGCTC GCGGCGGCGC GGCGGTCCGT GGCGCGCGCC GCCGCGATCG CGGGCTCCGC CTCCTCCTCC
GCCTCCGGCG GCGGCGCGGC GGACGACGTC GTGTCGAAGG TCGTGTCCCG GTCGTTCGAG TACCTCATGA CGGTCAACCT
CGGCTCGCCG CCGCGCTCGA TGCTGGCCAT CGCCGACACG GGCAGCGACC TCGTGTGGGT GAAGTGCAAG AAGGGGAACA
ACGACACCTC ATCGGCGGCG GCGCCGACGA CGCAGTTCGA CCCGTCCCGG TCGTCGACGT ACGGCCGCGT GAGCTGCCAA
ACCGACGCCT GCGAGGCGCT CGGCCGCGCC ACCTGCGACG ACGGGTCGAA CTGCGCCTAC CTCTACGCCT ACGGCGACGG
GTCGAACACC ACCGGCGTCC TCTCCACCGA AACCTTCACC TTCGACGACG GCGGCTCGGG GAGGagcccc cgccaggtgc
gcgtcggcgg cgtcaagttc ggctgctcca ccgcgacggc cggctcgttc ccggccgacg gtctggtcgg cctcggcggc
ggcgcggtct ccctcgtgac gcagctcggc ggcgcgacgt cgctcgggcg gagattctcc tactgcctcg tcccgcactc
cgtcaacgcc tcgtcggcgc tcaacttcgg cgccctcgcc gacgtcaccg agcccggcgc ggcgagcacg ccgctcgtcg
ccggcgacgt ggacacgtac tacaccgtgg tcctcgactc cgtcaaggtc gggaacaaga cggtggcgtc ggcggcgagc
tcccgcatca tcgtggactc cggcacgacg ctgacgttcc tcgacccgtc gctgctgGGG CCGATCGTCG ACGAGCTCTC
CCGCCGGATC ACGCTGCCGC CGGTGCAGTC GCCGGACGGG CTGCTGCAGC TGTGCTACAA CGTTGCCGGG CGGGAGGTGG
AGGCCGGCGA GAGCATCCCG GACTTGACGC TGGAGTTCGG CGGCGGCGCG GCGGTGGCGC TGAAGCCGGA GAACGCGTTC
GTGGCGGTGC AGGAGGGGAC GCTGTGCCTG GCAATCGTGG CGACGACGGA GCAGCAGCCG GTGTCCATCC TCGGGAACCT
CGCGCAGCAG AACATCCACG TCGGCTACGA CCTCGACGCC GGCACGGTCA CCTTCGCCGG CGCCGACTGC GCCGGCTCAT
CCTAG

Locus: Os01g0178600

Loading...

Locus: Os01g0178600

Loading...