Os01t0179400-01

Locus

Os01g0179400

Description

Amyloplast-localized protein containing DUF490, Regulation of starch grain sizes

RAP-DB Gene Symbol Synonym(s)

SSG4

RAP-DB Gene Name Synonym(s)

SUBSTANDARD STARCH GRAIN4, substandard starch grain4, substandard starch grain 4

CGSNL Gene Symbol

SSG4

CGSNL Gene Name

SUBSTANDARD STARCH GRAIN4

Oryzabase Gene Symbol Synonym(s)

OsSSG4

Oryzabase Gene Name Synonym(s)

substandard starch grain4, substandard starch grain 4

Transcript Evidence

AB856288

Protein Evidence

W0RYD3

Literature

PMID: 24335509

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

February 20, 2014

Functional domain (InterPro)

Protein of unknown function DUF490 (IPR007452)

Expression Databases

TENOR (Os01t0179400-01)

Others

Oryzabase (19623)

Transcript

6843 bp

>Os01t0179400-01 Amyloplast-localized protein containing DUF490, Regulation of starch grain sizes
GGAGAATACGCAAAACGATCCCCCCGGCGAAAGCCAAGCCAAGCATCTCTCCCCTCGCCG
CACGCAACGCCAAAATCAAATGGTCACCTAGGCTCGCCGCCGCCGCCGCCGCCGCCGCCG
CTCGCCGCCGGCCGCAATGTCCCACTGCCTCCGGGCGTCGCCCTTCCTCTCCCCGCCGCC
TCCCCTCCTCCACCCGTCCCGCCGCCGCCGCCACCGCCAGGGAGGCTGCATCCACACCTC
CCCGGGGACGAGGCCCCTCGTCGCGCGCGCCCGCTTCGACCCGCCGCCGCTGCTCCGCCT
CAAGGTCTCCGACTCCAGCGACTGCCCCGCGCCGCACCACCCGCACTCGCAGCACCAGCC
GCTGCTCCCGACGCGGCGGCAGCAGCAGCAGCCGCCGCCGCCGTACCAGGCCCTCGTCGC
CTCCCTCGCGCCGCTATGGCGGGAGGGGCTCTTCCTCGTGCGCTGCTCCGTCTTCGCGGC
GGCGCTCTCCGTTGCCGCCGCGCTCTCCTGGTACGCGCAGCTCCGCGCCCGCTCCTTCGT
CGAGTCTCGCCTCCTCCCCGCCGCGTGCGCCGCCCTGGGGGAATTCCTCCAGCGGGAGGT
CCACCTCGGCAGGGTGCGCAGCGTCTCCCCGCTCGGGATCACCCTCCACACCTGCTCCAT
CGGCCCGCACGCGGAGGAGTTCTCCTGCGCCGAGGTGCCCGTCATGAAGATCAGGGTCAG
GCCATTCgccagcctcaggcgggggagggtcgtcgtcgacgccgtgctgtccgagccctc
ggcgctcgtggcccagaggaaggATTTCTCATGGCTGGGGCTCCCCGCGCCATCCGAGGG
CTCACCCAAGAGGCATTCGGGGGAGGAGGGGATCGATTACCGCACCAAAACGAGGCGGCT
CGCGAGGGAGAAGGCCGCCGAGCAGTGGAATGAGGAGAGGGATAAGGCTGCAAGGGAAGC
CGCCGAAATGGGATACATTGTTCCTAGTGCCCAATCGATTTCGCCTTCGATCGATGAGAT
GATGGAAGACGATGGACCTGTTGATACTGGGAAATCCAGCCCACACCTATGTCCTGATGA
AATGCACAGGAAGGACCATCACATTGATGCGGGCATTGACTCCAGCTCGAAACATGCCGA
TTTGGAGAAATCGTTCGGCGTGAAAGCTCGTATTCCAGGGATCAGCTTCTGGTCTAGGAT
GATTCCAAACCCTAGCAGGCGCAGGTACAGGAGGAAGGCTCATAGCAAGTTGATATCGGA
CACTGACAATTCTTCTCAGCAAAGGATCCTTAGGCGTAGCGCATATGCTGCTGTTGCATA
TTTTCAAAACGAGTGTAGTGGTAATCCTGATGACTCTTTGCCTGGTCCTGGTGAAAGCTC
ATCTGATGGAGGTCATACAAATGGTGGTGGTGAGGAAGGTAGTCCAAATGATGGACCAAC
TGAATACTCTGAGACAACATCTATGGATTATGGTGAATTACCGCCAGAGAAAAGCAATTT
CGCTAGTACAATGCTGATTGGCAATACGGATGTCTTGAATGGAAGTTCTCATAATCAACA
ACCTAGTCAGATTAGTTCACACTCTTGGGAAAATAATGAGCAAGTATCTGAAGCCCCTGT
TTTGAAGAAACGTAAAAATATATCCGAAGATGATTACCGGCAAGAATTCGATTTTGGGGC
TTTTGGTTCATGCACATATGCTCACAACTGGCTATCATTTTGGCCCTTCCAATTGAAGGG
GTTTCCTGTCGGGTTCAATGCACCATCAGCTTCTCTGAATGTTCAGATCCAGAAGTTGAG
GTCATTGTTTGCTATTGGTCCAGGAGACAATTCTGCCGAACTTTCACAAGGTGTTGGCCA
GATCCATCCTGGTGCTGTTCAACAAACTCTTCCCATCACCCTGGATTCTGTATATTTCAA
TGGAGGGAATCTGATGCTTCTAGGATATGGTGACCAAGAACCAAGGGAAATGAAACATGC
TAATGGACACATCAAGTTCAAAAACAGTTATAATCGTGTACATGTGCATGTCACTGGGAA
CTGCATGGAGTGGAGGCAAGACCGGACTTCTCAAGGAGGGGGTTATCTTTCTACTGATGT
TTTTGTTGATATAGCTGAGCAAACATGGCATGCTAATTTGAATGTAGTCAATGCTTTTGC
TCCGCTGTTTGAGCGGATCCTCGAAATACCAGTTGTTTGGAATAAAGGGAGAGCTACTGG
CGAGGTGCATCTCTGTATGTCGAAGGGTGATAGTTTCCCGAGCATTCATGGCCAGCTTGA
TGTGAAGGGCCTAGCTTTTCAGATTTTAGATGCTCCATCATCGTTTTCAGATATAGTGGC
AACTCTATCTTTTCGTGGTCAAAGAGTATTTCTACATAATGCAAGTGGTTGGTTTGGTGA
TGCTCCGGTAGAAGCTTCTGGTGATTTTGGTCTAAATCCTGAGGATGGAGAGTTTCATCT
AATGTGCCAGGTTCCATCAGTTGAAGTTAATGCACTTATGAAAACAATGAAAATGCGACC
CTTAATGTTTCCGTTGGCTGGTGCTGTTACTGCCGTATTTAACTGTCAAGGGCCTCTTGA
TGCTCCTGTTTTTGTTGGAAGTGGGATTGTCTCAAGGAAGTCTCTTTCAGTATCTGGTAT
GCTTCCATCGGCAGCCTCTGAAGCTGTGATGCAAAACAAAGAGTCTGGTGCAGTGGCCGC
TTTTGATCATATTCCCTTCACTCATGTTTCAGCAAATTTCACTTTCAACCTTGATAACTG
CGTTGCTGATTTATATGGCATTAGAGCATGCCTTTTGGATGGTGGAGAAATTCGAGGAGC
TGGTAATGTTTGGATTTGCCCAGAGGGGGAAGGTGATGATTCTGCTATGGATATTAATTT
GTCTGGGAGCATTTTACTTGACAAAGTTTTGCATCGCTACATTCCTGGAGGCATCCAGTT
GATTCCACTCAAAATTGGAGAGCTCAATGGAGAGACTAGACTTTCTGGTTCCCTTATTAG
GCCGAAATTTGATATCAAATGGGCTGCACCAAATGCAGAAGATTCTTTTTCTGATGCGCG
TGGCAATATTGTTATTGCACATGACTATATTATGGTCAACTCATCATCAGTTTCTTTTGA
TTTGAATACTCATATTCAAACATCATATATTGATGATTATTTGCTGCATAAGGAGATGTA
TCAAAGGAAAAAAATTATGCCACTGATTGTGGAGGGTGTGGATTTGGATTTACGCATGAG
GGGCTTTGAGTTTGCTCATATAGCTTCTTCGATACCTTTTGATTCACCACGGCCTCTACA
TTTGAAAGCATCTGGAAGGTTTAAATTTCAAGGAAAAGTGGTGAAATATAGCCAGTTAGT
TGATGAGAAGAACCATGGTGCTATACAAGGTACCATTGACCAAAGTAAGCTTGAGAACGA
TGTATCAAGGCTTGTTGGCGAGATTTCTCTGTCAGGAATTAAACTTAACCAACTTATGCT
GGCACCACAATCTACTGGTTTTCTTTCCATATCACCAGATTCTATAATGTTAAATGCTAC
AGGCAGACCCGATGAAAATTTTTCCATAGAAGTGAATGTGCCATTATTTTTTGGCACACA
CGAGGCCATTCAAGACGGAAGGCTGTTGTCAATATTCCTCCAAAAGGGGCAGCTGAGATC
TAATATCTGCTATCACCCTGAAAATTTGACTAGTTTGGAGGTTCGAAATTTGCCACTTGA
TGAGCTGGAGTTTGCTTCATTACGTGGGTTTGTTCAGAAGGCAGAACTCCAGCTTAATTT
CCAGAAAAGAAGAGGTCATGGTTTGCTGTCAGTTATCCGCCCAAAATTTAGTGGCATGCT
TGGGGAATCACTTGATATAGCTGCTCGATGGAGTGGTGATGTTATTACTATGGAAAAATC
AGTCCTAGAGCAAGCTAATAGCAAGTATGAACTTCAAGGGGAGTATGTTTTTCCTGGAAC
ACGTGATAGATTCCCTATGGAAAGTCAGAGTAATGGTTTCATAGAGAAAGCGATGGGAGG
GCATCTTGGTAGCATGATGTCTTCGATGGGCAGGTGGAGGATGAGATTAGAAGTACCTGG
TGCTGAAGTAGCTGAAATGCTTCCGTTGGCAAGACTTCTATCACGAAGTACAGACCCAGC
TATTCGTTCCAGATCAAAGGAACTTTTTATGCAAACTTTGCATTCTGTTGGATTCAATGC
TGAAAGTCTTCGTGACCAGCTAAAGGCATTAGAAATGTATCCTGATTGGTTGGATGATGA
TACAATTGAGGATATAACTCTTCCTGGCTTAGCTGAACTGAGAGGTTATTGGCGTGGTTC
TCTTGATGCCAGTGGTGGAGGGAACGGCGATACTATGGCTGATTTTGATTTCAATGGTGA
AGATTGGGAGTGGGGCACTTACAAGACACAGCGTGTTCTGGCATCTGGTTCATTCAGCAA
TAATGATGGCCTGCGTCTTGATAAGTTATTTATTCAGAAGGATAATGCCACTCTTCATGC
TGATGGATCAATTCTTGGCCCATTAACAAATCTTCACTTTGCTGTGCTTAATTTCCCAGT
TGGTCTTATACCCGCATTAGTTCAGGCTATAGAATCATCAACCACAGACTCGATTCATTT
TCTGAGGCAATGGTTGACACCAATCAAAGGCATTCTACATATGGAGGGAGATTTGAGAGG
TACTCTAGCAAAGCCTGAATGTGATGTTCAAATAAGACTTCTTGATGGCACCATTGGAGG
CATTGATCTCGGAAGAGCTGAAGTATTAGCTTCTGTAACCCCAACAAGCCGTTTTGTTTT
TGATGCAAACTTCGAACCGACCATACAAAGTGGGCACGTTAACATTCAAGGTAGTGTTCC
TGTTACTTATGTAGACAGCAACTCCATTGAGGAAGACCTGGAAGGGGGAGATGGTAAACA
AGGTATAATAAGAATCCCTGTTTGGGCGAAAGACAGAGGCTTGACAAATGACATCAGCGA
AACAAGAATCATGAGAGACAAGCCTGATGAGGGTTGGGAGTTTCAATTAGCTGAAAGCCT
AAAGGGTTTAAGCTGGAATATGCTAGAACCAGGCGAAGTGAGAATAAATGCAGATATAAA
GGATGGGGGTATGACACTGATAACTGCACTGAGTCCTTACTCAAACTGGCTTCAAGGCTA
TGCTGAAGTTCTTCTCCAGGTTAAAGGCACTGTTGATCACCCTGTTGTTGATGGGTCTGC
CTCATTTCACCGTGCAACCGTGGCTTCTCCTTTCCTTCGGACACCACTGACAAATTTCGC
TGGCAATGTTCATGTTATATCTAACAGACTATGTATCAGTTCCATGGAAAGCAGAGTTGG
GAGGAAAGGGAGATTGTCAATGAAAGGGACTCTACCTCTCCACAATATTGAGCCATCAGC
CAATGACAAGATTGAACTGAAATGCGAAGTTCTGGACATACGAGCAAAAAATATTTTGAG
TGGCCAAGTAGACAGCCAGCTGCAGGTTACAGGCTCAATATTGCGGCCAGATGTCTCTGG
AATGATTCGGCTAAGCCATGGTGAAGCGTATTTGCCTCATGATAAAGGCAATGGTGCTGT
TGCCACCAGGCTGTCTTCAAATAAATCCATCTCTGTTCCTGCTGGTTTTGACCAAAGAAC
AGTCTCACGAGATGTCTCCCACTTTCTAGGATCACTATCAACTAGTCCAGACGGCCAACA
ATCAGAAACTGAAAGGACTCCTGAACATGGAAGTTTTAAGCCAAACATTGATGCCCGACT
CAATGATCTGAAGCTCACATTTGGACCTGAATTAAGGATTGTTTATCCTTTAATTTTGAA
TTTTGCTGTGAGTGGCGACCTTGAGCTTAATGGCATGGTTCATCCGAAGTACATAAGACC
TAAGGGTGTCTTAACTTTTGAAAATGGTGAGGTCAATTTGGTTGCTACTCAGGTAAGACT
TAAAAATGATCATTTGAATGTAGCAAAGTTTGAGCCAGATCTTGGTTTGGATCCTATTCT
GGATCTTGTTCTTGTTGGATCTGAGTGGCAATTTAAGATCCAAAGTCGAGCAAGCATGTG
GCAAGACAATCTTGTTGTAACCTCCACACGCTCTGTGGACCAGGATGTTCTTTCACCTAG
TGAGGCTGCAAAGGTTTTTGAGTCACAGCTTGCGGAGTCACTATTGGAAGGTGATGGACA
GCTCGCGTTCAAGAAACTCGCAACTGCAACACTCGAAACTTTGATGCCAAGGATTGAAGG
CAAGGGTGAATTTGGTCAAGCACGGTGGCGACTGGTTTATGCACCGCAGATTCCGAGTTT
ACTATCTGTAGATCCAACGGTTGACCCACTTAAATCGCTGGCAAACAATATATCTTTTGC
TACTGAGGTCGAAGTGCAACTTGGAAAACGCCTTCAGGCCTCTGTTGTCAGGCAGATGAA
AGATTCAGAAATGGCAATGCAGTGGTCACTCATATATCAGCTAACCAGCAGGCTCCGTGT
TCTCTTCCAATCTACGCCGTCCAATCGACTTCTCTTCGAGTACTCTGCAACATCCCAGGG
TTGATTCATTTTTGCCCACTACACAGAGCAGGAGCTGTGGAATGGCAGCTGGTCTGTACA
AAGATGTGGCGCACCGACACCGATCAATTGTTCTTGTAGATAATGGAAGTTTTGATAGGC
AGGCAGTTGTACATGTAGACTTGCTGATGTTTTTGCTCTTTGTTGTATCTACATTCTTTT
TCTCGGAAACAAAGTTTCTGGGTTTGTACATAGGTAGCAAATTTTAGCTCCTTTAGCTAG
TTAACGTAAGATGTAAAGAACTACCTGCATAAATTATATGAAAATTTCCAATCTCGTGGA
GTC

CDS

6408 bp

>Os01t0179400-01 Amyloplast-localized protein containing DUF490, Regulation of starch grain sizes
ATGTCCCACTGCCTCCGGGCGTCGCCCTTCCTCTCCCCGCCGCCTCCCCTCCTCCACCCG
TCCCGCCGCCGCCGCCACCGCCAGGGAGGCTGCATCCACACCTCCCCGGGGACGAGGCCC
CTCGTCGCGCGCGCCCGCTTCGACCCGCCGCCGCTGCTCCGCCTCAAGGTCTCCGACTCC
AGCGACTGCCCCGCGCCGCACCACCCGCACTCGCAGCACCAGCCGCTGCTCCCGACGCGG
CGGCAGCAGCAGCAGCCGCCGCCGCCGTACCAGGCCCTCGTCGCCTCCCTCGCGCCGCTA
TGGCGGGAGGGGCTCTTCCTCGTGCGCTGCTCCGTCTTCGCGGCGGCGCTCTCCGTTGCC
GCCGCGCTCTCCTGGTACGCGCAGCTCCGCGCCCGCTCCTTCGTCGAGTCTCGCCTCCTC
CCCGCCGCGTGCGCCGCCCTGGGGGAATTCCTCCAGCGGGAGGTCCACCTCGGCAGGGTG
CGCAGCGTCTCCCCGCTCGGGATCACCCTCCACACCTGCTCCATCGGCCCGCACGCGGAG
GAGTTCTCCTGCGCCGAGGTGCCCGTCATGAAGATCAGGGTCAGGCCATTCgccagcctc
aggcgggggagggtcgtcgtcgacgccgtgctgtccgagccctcggcgctcgtggcccag
aggaaggATTTCTCATGGCTGGGGCTCCCCGCGCCATCCGAGGGCTCACCCAAGAGGCAT
TCGGGGGAGGAGGGGATCGATTACCGCACCAAAACGAGGCGGCTCGCGAGGGAGAAGGCC
GCCGAGCAGTGGAATGAGGAGAGGGATAAGGCTGCAAGGGAAGCCGCCGAAATGGGATAC
ATTGTTCCTAGTGCCCAATCGATTTCGCCTTCGATCGATGAGATGATGGAAGACGATGGA
CCTGTTGATACTGGGAAATCCAGCCCACACCTATGTCCTGATGAAATGCACAGGAAGGAC
CATCACATTGATGCGGGCATTGACTCCAGCTCGAAACATGCCGATTTGGAGAAATCGTTC
GGCGTGAAAGCTCGTATTCCAGGGATCAGCTTCTGGTCTAGGATGATTCCAAACCCTAGC
AGGCGCAGGTACAGGAGGAAGGCTCATAGCAAGTTGATATCGGACACTGACAATTCTTCT
CAGCAAAGGATCCTTAGGCGTAGCGCATATGCTGCTGTTGCATATTTTCAAAACGAGTGT
AGTGGTAATCCTGATGACTCTTTGCCTGGTCCTGGTGAAAGCTCATCTGATGGAGGTCAT
ACAAATGGTGGTGGTGAGGAAGGTAGTCCAAATGATGGACCAACTGAATACTCTGAGACA
ACATCTATGGATTATGGTGAATTACCGCCAGAGAAAAGCAATTTCGCTAGTACAATGCTG
ATTGGCAATACGGATGTCTTGAATGGAAGTTCTCATAATCAACAACCTAGTCAGATTAGT
TCACACTCTTGGGAAAATAATGAGCAAGTATCTGAAGCCCCTGTTTTGAAGAAACGTAAA
AATATATCCGAAGATGATTACCGGCAAGAATTCGATTTTGGGGCTTTTGGTTCATGCACA
TATGCTCACAACTGGCTATCATTTTGGCCCTTCCAATTGAAGGGGTTTCCTGTCGGGTTC
AATGCACCATCAGCTTCTCTGAATGTTCAGATCCAGAAGTTGAGGTCATTGTTTGCTATT
GGTCCAGGAGACAATTCTGCCGAACTTTCACAAGGTGTTGGCCAGATCCATCCTGGTGCT
GTTCAACAAACTCTTCCCATCACCCTGGATTCTGTATATTTCAATGGAGGGAATCTGATG
CTTCTAGGATATGGTGACCAAGAACCAAGGGAAATGAAACATGCTAATGGACACATCAAG
TTCAAAAACAGTTATAATCGTGTACATGTGCATGTCACTGGGAACTGCATGGAGTGGAGG
CAAGACCGGACTTCTCAAGGAGGGGGTTATCTTTCTACTGATGTTTTTGTTGATATAGCT
GAGCAAACATGGCATGCTAATTTGAATGTAGTCAATGCTTTTGCTCCGCTGTTTGAGCGG
ATCCTCGAAATACCAGTTGTTTGGAATAAAGGGAGAGCTACTGGCGAGGTGCATCTCTGT
ATGTCGAAGGGTGATAGTTTCCCGAGCATTCATGGCCAGCTTGATGTGAAGGGCCTAGCT
TTTCAGATTTTAGATGCTCCATCATCGTTTTCAGATATAGTGGCAACTCTATCTTTTCGT
GGTCAAAGAGTATTTCTACATAATGCAAGTGGTTGGTTTGGTGATGCTCCGGTAGAAGCT
TCTGGTGATTTTGGTCTAAATCCTGAGGATGGAGAGTTTCATCTAATGTGCCAGGTTCCA
TCAGTTGAAGTTAATGCACTTATGAAAACAATGAAAATGCGACCCTTAATGTTTCCGTTG
GCTGGTGCTGTTACTGCCGTATTTAACTGTCAAGGGCCTCTTGATGCTCCTGTTTTTGTT
GGAAGTGGGATTGTCTCAAGGAAGTCTCTTTCAGTATCTGGTATGCTTCCATCGGCAGCC
TCTGAAGCTGTGATGCAAAACAAAGAGTCTGGTGCAGTGGCCGCTTTTGATCATATTCCC
TTCACTCATGTTTCAGCAAATTTCACTTTCAACCTTGATAACTGCGTTGCTGATTTATAT
GGCATTAGAGCATGCCTTTTGGATGGTGGAGAAATTCGAGGAGCTGGTAATGTTTGGATT
TGCCCAGAGGGGGAAGGTGATGATTCTGCTATGGATATTAATTTGTCTGGGAGCATTTTA
CTTGACAAAGTTTTGCATCGCTACATTCCTGGAGGCATCCAGTTGATTCCACTCAAAATT
GGAGAGCTCAATGGAGAGACTAGACTTTCTGGTTCCCTTATTAGGCCGAAATTTGATATC
AAATGGGCTGCACCAAATGCAGAAGATTCTTTTTCTGATGCGCGTGGCAATATTGTTATT
GCACATGACTATATTATGGTCAACTCATCATCAGTTTCTTTTGATTTGAATACTCATATT
CAAACATCATATATTGATGATTATTTGCTGCATAAGGAGATGTATCAAAGGAAAAAAATT
ATGCCACTGATTGTGGAGGGTGTGGATTTGGATTTACGCATGAGGGGCTTTGAGTTTGCT
CATATAGCTTCTTCGATACCTTTTGATTCACCACGGCCTCTACATTTGAAAGCATCTGGA
AGGTTTAAATTTCAAGGAAAAGTGGTGAAATATAGCCAGTTAGTTGATGAGAAGAACCAT
GGTGCTATACAAGGTACCATTGACCAAAGTAAGCTTGAGAACGATGTATCAAGGCTTGTT
GGCGAGATTTCTCTGTCAGGAATTAAACTTAACCAACTTATGCTGGCACCACAATCTACT
GGTTTTCTTTCCATATCACCAGATTCTATAATGTTAAATGCTACAGGCAGACCCGATGAA
AATTTTTCCATAGAAGTGAATGTGCCATTATTTTTTGGCACACACGAGGCCATTCAAGAC
GGAAGGCTGTTGTCAATATTCCTCCAAAAGGGGCAGCTGAGATCTAATATCTGCTATCAC
CCTGAAAATTTGACTAGTTTGGAGGTTCGAAATTTGCCACTTGATGAGCTGGAGTTTGCT
TCATTACGTGGGTTTGTTCAGAAGGCAGAACTCCAGCTTAATTTCCAGAAAAGAAGAGGT
CATGGTTTGCTGTCAGTTATCCGCCCAAAATTTAGTGGCATGCTTGGGGAATCACTTGAT
ATAGCTGCTCGATGGAGTGGTGATGTTATTACTATGGAAAAATCAGTCCTAGAGCAAGCT
AATAGCAAGTATGAACTTCAAGGGGAGTATGTTTTTCCTGGAACACGTGATAGATTCCCT
ATGGAAAGTCAGAGTAATGGTTTCATAGAGAAAGCGATGGGAGGGCATCTTGGTAGCATG
ATGTCTTCGATGGGCAGGTGGAGGATGAGATTAGAAGTACCTGGTGCTGAAGTAGCTGAA
ATGCTTCCGTTGGCAAGACTTCTATCACGAAGTACAGACCCAGCTATTCGTTCCAGATCA
AAGGAACTTTTTATGCAAACTTTGCATTCTGTTGGATTCAATGCTGAAAGTCTTCGTGAC
CAGCTAAAGGCATTAGAAATGTATCCTGATTGGTTGGATGATGATACAATTGAGGATATA
ACTCTTCCTGGCTTAGCTGAACTGAGAGGTTATTGGCGTGGTTCTCTTGATGCCAGTGGT
GGAGGGAACGGCGATACTATGGCTGATTTTGATTTCAATGGTGAAGATTGGGAGTGGGGC
ACTTACAAGACACAGCGTGTTCTGGCATCTGGTTCATTCAGCAATAATGATGGCCTGCGT
CTTGATAAGTTATTTATTCAGAAGGATAATGCCACTCTTCATGCTGATGGATCAATTCTT
GGCCCATTAACAAATCTTCACTTTGCTGTGCTTAATTTCCCAGTTGGTCTTATACCCGCA
TTAGTTCAGGCTATAGAATCATCAACCACAGACTCGATTCATTTTCTGAGGCAATGGTTG
ACACCAATCAAAGGCATTCTACATATGGAGGGAGATTTGAGAGGTACTCTAGCAAAGCCT
GAATGTGATGTTCAAATAAGACTTCTTGATGGCACCATTGGAGGCATTGATCTCGGAAGA
GCTGAAGTATTAGCTTCTGTAACCCCAACAAGCCGTTTTGTTTTTGATGCAAACTTCGAA
CCGACCATACAAAGTGGGCACGTTAACATTCAAGGTAGTGTTCCTGTTACTTATGTAGAC
AGCAACTCCATTGAGGAAGACCTGGAAGGGGGAGATGGTAAACAAGGTATAATAAGAATC
CCTGTTTGGGCGAAAGACAGAGGCTTGACAAATGACATCAGCGAAACAAGAATCATGAGA
GACAAGCCTGATGAGGGTTGGGAGTTTCAATTAGCTGAAAGCCTAAAGGGTTTAAGCTGG
AATATGCTAGAACCAGGCGAAGTGAGAATAAATGCAGATATAAAGGATGGGGGTATGACA
CTGATAACTGCACTGAGTCCTTACTCAAACTGGCTTCAAGGCTATGCTGAAGTTCTTCTC
CAGGTTAAAGGCACTGTTGATCACCCTGTTGTTGATGGGTCTGCCTCATTTCACCGTGCA
ACCGTGGCTTCTCCTTTCCTTCGGACACCACTGACAAATTTCGCTGGCAATGTTCATGTT
ATATCTAACAGACTATGTATCAGTTCCATGGAAAGCAGAGTTGGGAGGAAAGGGAGATTG
TCAATGAAAGGGACTCTACCTCTCCACAATATTGAGCCATCAGCCAATGACAAGATTGAA
CTGAAATGCGAAGTTCTGGACATACGAGCAAAAAATATTTTGAGTGGCCAAGTAGACAGC
CAGCTGCAGGTTACAGGCTCAATATTGCGGCCAGATGTCTCTGGAATGATTCGGCTAAGC
CATGGTGAAGCGTATTTGCCTCATGATAAAGGCAATGGTGCTGTTGCCACCAGGCTGTCT
TCAAATAAATCCATCTCTGTTCCTGCTGGTTTTGACCAAAGAACAGTCTCACGAGATGTC
TCCCACTTTCTAGGATCACTATCAACTAGTCCAGACGGCCAACAATCAGAAACTGAAAGG
ACTCCTGAACATGGAAGTTTTAAGCCAAACATTGATGCCCGACTCAATGATCTGAAGCTC
ACATTTGGACCTGAATTAAGGATTGTTTATCCTTTAATTTTGAATTTTGCTGTGAGTGGC
GACCTTGAGCTTAATGGCATGGTTCATCCGAAGTACATAAGACCTAAGGGTGTCTTAACT
TTTGAAAATGGTGAGGTCAATTTGGTTGCTACTCAGGTAAGACTTAAAAATGATCATTTG
AATGTAGCAAAGTTTGAGCCAGATCTTGGTTTGGATCCTATTCTGGATCTTGTTCTTGTT
GGATCTGAGTGGCAATTTAAGATCCAAAGTCGAGCAAGCATGTGGCAAGACAATCTTGTT
GTAACCTCCACACGCTCTGTGGACCAGGATGTTCTTTCACCTAGTGAGGCTGCAAAGGTT
TTTGAGTCACAGCTTGCGGAGTCACTATTGGAAGGTGATGGACAGCTCGCGTTCAAGAAA
CTCGCAACTGCAACACTCGAAACTTTGATGCCAAGGATTGAAGGCAAGGGTGAATTTGGT
CAAGCACGGTGGCGACTGGTTTATGCACCGCAGATTCCGAGTTTACTATCTGTAGATCCA
ACGGTTGACCCACTTAAATCGCTGGCAAACAATATATCTTTTGCTACTGAGGTCGAAGTG
CAACTTGGAAAACGCCTTCAGGCCTCTGTTGTCAGGCAGATGAAAGATTCAGAAATGGCA
ATGCAGTGGTCACTCATATATCAGCTAACCAGCAGGCTCCGTGTTCTCTTCCAATCTACG
CCGTCCAATCGACTTCTCTTCGAGTACTCTGCAACATCCCAGGGTTGA

Protein

2136 aa

>Os01t0179400-01 Amyloplast-localized protein containing DUF490, Regulation of starch grain sizes
MSHCLRASPFLSPPPPLLHPSRRRRHRQGGCIHTSPGTRPLVARARFDPPPLLRLKVSDS
SDCPAPHHPHSQHQPLLPTRRQQQQPPPPYQALVASLAPLWREGLFLVRCSVFAAALSVA
AALSWYAQLRARSFVESRLLPAACAALGEFLQREVHLGRVRSVSPLGITLHTCSIGPHAE
EFSCAEVPVMKIRVRPFASLRRGRVVVDAVLSEPSALVAQRKDFSWLGLPAPSEGSPKRH
SGEEGIDYRTKTRRLAREKAAEQWNEERDKAAREAAEMGYIVPSAQSISPSIDEMMEDDG
PVDTGKSSPHLCPDEMHRKDHHIDAGIDSSSKHADLEKSFGVKARIPGISFWSRMIPNPS
RRRYRRKAHSKLISDTDNSSQQRILRRSAYAAVAYFQNECSGNPDDSLPGPGESSSDGGH
TNGGGEEGSPNDGPTEYSETTSMDYGELPPEKSNFASTMLIGNTDVLNGSSHNQQPSQIS
SHSWENNEQVSEAPVLKKRKNISEDDYRQEFDFGAFGSCTYAHNWLSFWPFQLKGFPVGF
NAPSASLNVQIQKLRSLFAIGPGDNSAELSQGVGQIHPGAVQQTLPITLDSVYFNGGNLM
LLGYGDQEPREMKHANGHIKFKNSYNRVHVHVTGNCMEWRQDRTSQGGGYLSTDVFVDIA
EQTWHANLNVVNAFAPLFERILEIPVVWNKGRATGEVHLCMSKGDSFPSIHGQLDVKGLA
FQILDAPSSFSDIVATLSFRGQRVFLHNASGWFGDAPVEASGDFGLNPEDGEFHLMCQVP
SVEVNALMKTMKMRPLMFPLAGAVTAVFNCQGPLDAPVFVGSGIVSRKSLSVSGMLPSAA
SEAVMQNKESGAVAAFDHIPFTHVSANFTFNLDNCVADLYGIRACLLDGGEIRGAGNVWI
CPEGEGDDSAMDINLSGSILLDKVLHRYIPGGIQLIPLKIGELNGETRLSGSLIRPKFDI
KWAAPNAEDSFSDARGNIVIAHDYIMVNSSSVSFDLNTHIQTSYIDDYLLHKEMYQRKKI
MPLIVEGVDLDLRMRGFEFAHIASSIPFDSPRPLHLKASGRFKFQGKVVKYSQLVDEKNH
GAIQGTIDQSKLENDVSRLVGEISLSGIKLNQLMLAPQSTGFLSISPDSIMLNATGRPDE
NFSIEVNVPLFFGTHEAIQDGRLLSIFLQKGQLRSNICYHPENLTSLEVRNLPLDELEFA
SLRGFVQKAELQLNFQKRRGHGLLSVIRPKFSGMLGESLDIAARWSGDVITMEKSVLEQA
NSKYELQGEYVFPGTRDRFPMESQSNGFIEKAMGGHLGSMMSSMGRWRMRLEVPGAEVAE
MLPLARLLSRSTDPAIRSRSKELFMQTLHSVGFNAESLRDQLKALEMYPDWLDDDTIEDI
TLPGLAELRGYWRGSLDASGGGNGDTMADFDFNGEDWEWGTYKTQRVLASGSFSNNDGLR
LDKLFIQKDNATLHADGSILGPLTNLHFAVLNFPVGLIPALVQAIESSTTDSIHFLRQWL
TPIKGILHMEGDLRGTLAKPECDVQIRLLDGTIGGIDLGRAEVLASVTPTSRFVFDANFE
PTIQSGHVNIQGSVPVTYVDSNSIEEDLEGGDGKQGIIRIPVWAKDRGLTNDISETRIMR
DKPDEGWEFQLAESLKGLSWNMLEPGEVRINADIKDGGMTLITALSPYSNWLQGYAEVLL
QVKGTVDHPVVDGSASFHRATVASPFLRTPLTNFAGNVHVISNRLCISSMESRVGRKGRL
SMKGTLPLHNIEPSANDKIELKCEVLDIRAKNILSGQVDSQLQVTGSILRPDVSGMIRLS
HGEAYLPHDKGNGAVATRLSSNKSISVPAGFDQRTVSRDVSHFLGSLSTSPDGQQSETER
TPEHGSFKPNIDARLNDLKLTFGPELRIVYPLILNFAVSGDLELNGMVHPKYIRPKGVLT
FENGEVNLVATQVRLKNDHLNVAKFEPDLGLDPILDLVLVGSEWQFKIQSRASMWQDNLV
VTSTRSVDQDVLSPSEAAKVFESQLAESLLEGDGQLAFKKLATATLETLMPRIEGKGEFG
QARWRLVYAPQIPSLLSVDPTVDPLKSLANNISFATEVEVQLGKRLQASVVRQMKDSEMA
MQWSLIYQLTSRLRVLFQSTPSNRLLFEYSATSQG*

5'UTR

chr01:4127232..4127367 (+ strand) : 136 bp

CDS

chr01:4127368..4129194 (+ strand) : 1827 bp

chr01:4129515..4129714 (+ strand) : 200 bp

chr01:4129826..4129884 (+ strand) : 59 bp

chr01:4130127..4130233 (+ strand) : 107 bp

chr01:4130987..4131123 (+ strand) : 137 bp

chr01:4131219..4131284 (+ strand) : 66 bp

chr01:4131924..4132152 (+ strand) : 229 bp

chr01:4132250..4132331 (+ strand) : 82 bp

chr01:4132998..4133157 (+ strand) : 160 bp

chr01:4133252..4133777 (+ strand) : 526 bp

chr01:4134347..4134517 (+ strand) : 171 bp

chr01:4134641..4134700 (+ strand) : 60 bp

chr01:4134904..4135026 (+ strand) : 123 bp

chr01:4135906..4136181 (+ strand) : 276 bp

chr01:4136282..4136347 (+ strand) : 66 bp

chr01:4136500..4136631 (+ strand) : 132 bp

chr01:4136977..4137798 (+ strand) : 822 bp

chr01:4138026..4138306 (+ strand) : 281 bp

chr01:4138564..4138796 (+ strand) : 233 bp

chr01:4139022..4139260 (+ strand) : 239 bp

chr01:4139367..4139558 (+ strand) : 192 bp

chr01:4139808..4140080 (+ strand) : 273 bp

chr01:4140186..4140332 (+ strand) : 147 bp

3'UTR

chr01:4140333..4140631 (+ strand) : 299 bp

FASTA

>Os01t0179400-01 class=Sequence position=chr01:4127232..4140631 (+ strand)
GGAGAATACG CAAAACGATC CCCCCGGCGA AAGCCAAGCC AAGCATCTCT CCCCTCGCCG CACGCAACGC CAAAATCAAA
TGGTCACCTA GGCTCGCCGC CGCCGCCGCC GCCGCCGCCG CTCGCCGCCG GCCGCAATGT CCCACTGCCT CCGGGCGTCG
CCCTTCCTCT CCCCGCCGCC TCCCCTCCTC CACCCGTCCC GCCGCCGCCG CCACCGCCAG GGAGGCTGCA TCCACACCTC
CCCGGGGACG AGGCCCCTCG TCGCGCGCGC CCGCTTCGAC CCGCCGCCGC TGCTCCGCCT CAAGGTCTCC GACTCCAGCG
ACTGCCCCGC GCCGCACCAC CCGCACTCGC AGCACCAGCC GCTGCTCCCG ACGCGGCGGC AGCAGCAGCA GCCGCCGCCG
CCGTACCAGG CCCTCGTCGC CTCCCTCGCG CCGCTATGGC GGGAGGGGCT CTTCCTCGTG CGCTGCTCCG TCTTCGCGGC
GGCGCTCTCC GTTGCCGCCG CGCTCTCCTG GTACGCGCAG CTCCGCGCCC GCTCCTTCGT CGAGTCTCGC CTCCTCCCCG
CCGCGTGCGC CGCCCTGGGG GAATTCCTCC AGCGGGAGGT CCACCTCGGC AGGGTGCGCA GCGTCTCCCC GCTCGGGATC
ACCCTCCACA CCTGCTCCAT CGGCCCGCAC GCGGAGGAGT TCTCCTGCGC CGAGGTGCCC GTCATGAAGA TCAGGGTCAG
GCCATTCgcc agcctcaggc gggggagggt cgtcgtcgac gccgtgctgt ccgagccctc ggcgctcgtg gcccagagga
aggATTTCTC ATGGCTGGGG CTCCCCGCGC CATCCGAGGG CTCACCCAAG AGGCATTCGG GGGAGGAGGG GATCGATTAC
CGCACCAAAA CGAGGCGGCT CGCGAGGGAG AAGGCCGCCG AGCAGTGGAA TGAGGAGAGG GATAAGGCTG CAAGGGAAGC
CGCCGAAATG GGATACATTG TTCCTAGTGC CCAATCGATT TCGCCTTCGA TCGATGAGAT GATGGAAGAC GATGGACCTG
TTGATACTGG GAAATCCAGC CCACACCTAT GTCCTGATGA AATGCACAGG AAGGACCATC ACATTGATGC GGGCATTGAC
TCCAGCTCGA AACATGCCGA TTTGGAGAAA TCGTTCGGCG TGAAAGCTCG TATTCCAGGG ATCAGCTTCT GGTCTAGGAT
GATTCCAAAC CCTAGCAGGC GCAGGTACAG GAGGAAGGCT CATAGCAAGT TGATATCGGA CACTGACAAT TCTTCTCAGC
AAAGGATCCT TAGGCGTAGC GCATATGCTG CTGTTGCATA TTTTCAAAAC GAGTGTAGTG GTAATCCTGA TGACTCTTTG
CCTGGTCCTG GTGAAAGCTC ATCTGATGGA GGTCATACAA ATGGTGGTGG TGAGGAAGGT AGTCCAAATG ATGGACCAAC
TGAATACTCT GAGACAACAT CTATGGATTA TGGTGAATTA CCGCCAGAGA AAAGCAATTT CGCTAGTACA ATGCTGATTG
GCAATACGGA TGTCTTGAAT GGAAGTTCTC ATAATCAACA ACCTAGTCAG ATTAGTTCAC ACTCTTGGGA AAATAATGAG
CAAGTATCTG AAGCCCCTGT TTTGAAGAAA CGTAAAAATA TATCCGAAGA TGATTACCGG CAAGAATTCG ATTTTGGGGC
TTTTGGTTCA TGCACATATG CTCACAACTG GCTATCATTT TGGCCCTTCC AATTGAAGGG GTTTCCTGTC GGGTTCAATG
CACCATCAGC TTCTCTGAAT GTTCAGATCC AGAAGTTGAG GTCATTGTTT GCTATTGGTC CAGGAGACAA TTCTGCCGAA
CTTTCACAAG GTGTTGGCCA GATCCATCCT GGTGCTGTTC AACAAACTCT TCCCATCACC CTGGATTCTG TATATTTCAA
TGGAGGGAAT CTGATGCTTC TAGGATATGG TGACCAAGAA CCAAGGTTTG ACCTTGTAAT TCTCCATTTC CATTACAAAT
ACTGAAATCC CTGTTCTTTC TCATGCTTTT ATATGTCCAT TGTATCAGCC ACAAAAACCA TGTTATTTTC TTTTGACCAT
TTACAGCAGC CTATGAATGT ACTGCATTGA ATAGCAATCA CCCTTCAGTG TTACAAAATA TAGAATATTC TCATAATTGG
TTTCTGATTC ATGTTATTTG ATCTTATTTT CTCAGCTTAC AGTTGCCACA ATTTAATAGT ATTGGCCATC TATAACATTT
AAATGATTCC ACTACTTCCG TAGACTTATT GCCATCCAAC TGTAGGGAAA TGAAACATGC TAATGGACAC ATCAAGTTCA
AAAACAGTTA TAATCGTGTA CATGTGCATG TCACTGGGAA CTGCATGGAG TGGAGGCAAG ACCGGACTTC TCAAGGAGGG
GGTTATCTTT CTACTGATGT TTTTGTTGAT ATAGCTGAGC AAACATGGCA TGCTAATTTG AATGTAGTCA ATGCTTTTGC
TCCGGTAATG CATCTATTTT TCTGCTACTG TGTTTTTTAC TAGACTTCTC TTTGATGCAA ATATAGGATG TTGGTATTCT
TGATCTTTGT GTTCAAAGGT AGTTTTCATG TGCAGCTGTT TGAGCGGATC CTCGAAATAC CAGTTGTTTG GAATAAAGGG
AGAGCTACTG GCGAGGTGAT CTTCTAAACT TGATCTCTTA CATGTTATTT TCCCACTATT TGTATGGTCA CACATGCATG
TTTCTGAAGA CAAATTTTGA GATGTGACTT CCATATTCAC TTAATTAGTG GACTTATCCG GGGCTTTATT GCAAACTTTA
TAAAATCATC CATGTCTCGA GGAAACCCTT TTTTTTTTGT CTCAGCCTTG AACATATGAA TTTCTTACAG CAACGTTTCA
CCTTGTTATT CCTTCAGGTG CATCTCTGTA TGTCGAAGGG TGATAGTTTC CCGAGCATTC ATGGCCAGCT TGATGTGAAG
GGCCTAGCTT TTCAGATTTT AGATGCTCCA TCATCGTTTT CAGTATGTCC GTGCTTAACC CAATAATATG TTTTCTCGTA
CTCTGCATAT ATTTCTAGAG AATCATATTT TCCTTATTTC CCTCAAGTTA TGAGACACAT TAGCATGGTC TGATGCTTTC
TTATTAATTT GCTGTAACTT GACCACCAAT ATATTTTTTT TTGTCATTGA TGCCTTTTAC ATTTCCAATA AACATTGATA
CTTGTGTAAG CAATGTGATT ACATTTCCAG AGCATCTAGG GCTTATTGAT TTGTATACAT AAAGGCTAAC CTGGAATTTG
AATTTCAAGA TCTGAGAAAC AATTGGGCAT ACTTGATTGT AAGCAACATA TTGCAATTAT AGGTTTACAG TGCCTTAACT
TTCACCGATG TTGGATGTGA TAAATTTCTT GCACGCAACC AAAATGGGTT TAAAGAGGGA GATAAGGAAT ATGATGTGCA
TATTGGTTAT TAGTGTCATC AGGGTGAGAG CTGCCGATCT GCAGTGACGC CAGAAATGAA TTGGTCATTA GCATTTCAAG
GAAACAATAA CTATGGAATC AGTAGACTTA AGAATGGGGT GTGGGGAACA GTTATGTCCC AAGAACTGGA TTGTCCATTA
ATGTTTCCAA GTATCATATA TTTTTTTTTT TGGACACTAA CATCTTGCTG TGGATTATAG CTAGGTTGCC ATCCATGGTA
CTTTTTTGAA GTGTTAGCAT GTGGTAGCTT TCGAAATGAT TATTATTATT TTAACTAAAG CCTGAACTCA TTCAGGATAT
AGTGGCAACT CTATCTTTTC GTGGTCAAAG AGTATTTCTA CATAATGCAA GTGGTTGGTT TGGTGATGCT CCGGTAGAAG
CTTCTGGTGA TTTTGGTCTA AATCCTGAGG ATGGAGAGTT TCATCTAATG TGCCAGGTAT CTTTAAACTT TCGAAGTGCA
TATTTGATTT ATCATTCAAA TATTCCTTTA CATAACAGTG ATAAACTTGA TAATTTTGAT CTTCTTTCCA GGTTCCATCA
GTTGAAGTTA ATGCACTTAT GAAAACAATG AAAATGCGAC CCTTAATGTT TCCGGTACAA AATACTGTTC CTCTCATATT
TAGTTGCTGA ACTCCTCTGG AGATACTGGA TTCCTTTATC ATTTTGAGTT GGTTTGTTTC CACATAATTG CATAAAGGCT
GGACTATATG TGGACACATC ACAGATGATT TAACTATACT TCATTAGAAA TAAACTCGAA TCCATTCTGA TAAAAAAGAT
GAAGAGATGC TGTTTAGTGA TAAAGAAAAA TGTGTTTTCC ATCTGAAGTT CTGAAGTTGT AACTTGGTAC AGCTACATTG
AGTCCATATA TCTAGTACAA TGAAAAATTG TGACTTCTTG TATAGGAAGT GTTTTTATAT GGCTAGTGTC TTTATGGAAA
CACCTAGTTA ACTGGCTAAC CTATCTAGGT GCATCATTTG ATACCCATTA TCTCTTGTCT GCATTGCATG GCAATGGGCG
GTGGTTTATC TCAAAATTAC CTTCTTTGTT AGTACATGCA ATTGTGCAAA TAGCTTTTGG ATAGGCTATG TGTGTCAAAC
TCAATTTTTA ATATTTTACA ATGGTCTAAT GATGGTGTAA ATGTTTGCCA AAACACCTTT ATGGGTTATG GCTCAGACCC
TTAATGTTCA TCCTTTAAGA TTTGGTTTTA ATACAATATC TTAATTCGTT CAGTTGGCTG GTGCTGTTAC TGCCGTATTT
AACTGTCAAG GGCCTCTTGA TGCTCCTGTT TTTGTTGGAA GTGGGATTGT CTCAAGGAAG TCTCTTTCAG TATCTGGTAT
GCTTCCATCG GCAGCCTCTG AAGCTGTGAT GCAAAACAAA GAGTCTGGTG CAGTGGCCGC TTTTGATCAT ATTCCCTTCA
CTCATGTTTC AGCAAATTTC ACTTTCAACC TTGATAACTG CGTGAGTACA AATATAGCCA CCATTATTTC CAGTATGAAG
TTTATGGATG TTTGGCAGTG ATTTTCCCTT TACTATTTTG TATTTTCACT GGCTACAGGT TGCTGATTTA TATGGCATTA
GAGCATGCCT TTTGGATGGT GGAGAAATTC GAGGAGCTGG TAATGTTTGG ATTTGCCCAG AGGTACTGTA GTTATTGATT
GCACCCCTGG TCACTAATGC TTTCACATCT GTATTAAATT TAAGCATTCG CTAACTTCTT TCTACTTCTG CCATAGTGTA
TTCATTTTGT TTTGAATAGC CCATGTTTGT TGATTTCTCA ATCTATTTAG AGAGTTAAGT GGAGGATTTT GGGTTGTGAT
GTGTAAAGAG TAGATGGATA TATAATGACA TCAGTATCCT TTCAAAATGA AAATTAGTAT AAGAATTAAA CATTGCAAAT
CATTTCTTCC ATATTATTTC ATTGTTAACA GTGTTCTGTT ATGCCATAAA TATGGCTGAA GCCTAGTGGA GGTATTGCAT
TGTTCATTTC TCTGGGCTTA CAGCAATGTT TACCGCTAAA TGGGTTGAGG GTCCTGCAAA TAGCCAACTA CTCCTATTCT
TCTGTGCCAT TAAAGTTCCT AATAAGTGCA ATAATGCACC CAAGTACATA TGTGTAATTT TGTATACATT CAGTACCAAC
CCACTAGATA ATTTGCATTC TCAACCTGCA AGTTCTATTC CATTGAAAGA ATATGCATAC ATACAAATTG GGCCTACAAG
AAAGTCTCTG CTTAAGTATC TACTACTAGC ACTGCACTTA ATTAATTACC ACCTTATGCA AGTGTAATAT ATATTTAGAT
CTCTGCAGGG GGAAGGTGAT GATTCTGCTA TGGATATTAA TTTGTCTGGG AGCATTTTAC TTGACAAAGT TTTGCATCGC
TACATTCCTG GAGGCATCCA GTTGATTCCA CTCAAAATTG GAGAGCTCAA TGGAGAGACT AGACTTTCTG GTTCCCTTAT
TAGGCCGTGA GTACCTTAGA TGTGCCATCT GCAGTCCAAA TATCCTATTG GGCTGACTCT TTTTCTTACT CCTGATCTAA
CTGTGGATAA TATCTGACAG GAAATTTGAT ATCAAATGGG CTGCACCAAA TGCAGAAGAT TCTTTTTCTG ATGCGCGTGG
CAATATTGTT ATTGCACATG ACTATATTAT GGTCAACTCA TCATCAGTTT CTTTTGATTT GAATACTCAT ATTCAAACAT
CATATATTGA TGATTATTTG CTGCATAAGG AGATGTATCA AAGGAAAAAA ATTATGCCAC TGATTGTGGA GGGTGTGGAT
TTGGATTTAC GCATGAGGGG CTTTGAGTTT GCTCATATAG CTTCTTCGAT ACCTTTTGAT TCACCACGGC CTCTACATTT
GAAAGCATCT GGAAGGTTTA AATTTCAAGG AAAAGTGGTG AAATATAGCC AGTTAGTTGA TGAGAAGAAC CATGGTGCTA
TACAAGGTAC CATTGACCAA AGTAAGCTTG AGAACGATGT ATCAAGGCTT GTTGGCGAGA TTTCTCTGTC AGGAATTAAA
CTTAACCAAC TTATGCTGGC ACCACAATCT ACTGGTTTTC TTTCCATATC ACCAGATTCT ATAATGGTAA TTTGTTATTA
CATGCTCTTT TTCTTGTTCC CACGCTTTTA TATTTAAATT TCTTTACTTA AAGTGATTTG GTACCATATT ATGTTCCCTT
TGTTTGTAAA TTTCTTTGTT GCAATGCACT TAGCACAACT GGCAACAATG ATTGTTTCTG CAGGCAGACC TCAGTCTATA
TAGAGGATTT TATAAATTAA AACATCTCCT ACATTTAACA TTTTTAAACA CTAAAGGTAT TTCTCCATTA CCTCAAAACA
AAGTCAAAAC CAAGTAATGA ATATAATAGT AAAAAATAGA AATTTTACAT AATCTATATC AACCATTCGC CTTTTAACTA
AGGTTTGAGG ATCATGCATG CACAAAAGGT ATATTTTTCT TATCAATTTG ATTCACTTTT GTTTCCAGTT TATACTGCTT
CACAGACTTC ATTTCAATGA GAACATACTC TCAACAGATT ATAGCAAAAT TGAGAGCACA TATGCATTTA TTATTAAAGT
TGCATTTCAG TGTACTTGTG TGGGCTCCAA TTTATGCTCT CTTTTCATTT TGTCTTCTAC TCCATGTCCA AGCAGTTAAA
TGCTACAGGC AGACCCGATG AAAATTTTTC CATAGAAGTG AATGTGCCAT TATTTTTTGG CACACACGAG GCCATTCAAG
ACGGAAGGCT GTTGTCAATA TTCCTCCAAA AGGGGCAGCT GAGATCTAAT ATCTGCTATC ACCCTGAAAA TTTGACTAGT
TTGGAGGTAC TCTACTGGCA TGCTTGCATG TTATCCAACA GATCTTTCTA GAGCATTGTG ATCTTGCTTG GAGGTACTCT
GCTGGCATGA ATGTCTAATT TTCTCTATCC TTGTTTTCTT GTTGTAAAGG TTCGAAATTT GCCACTTGAT GAGCTGGAGT
TTGCTTCATT ACGTGGGTTT GTTCAGAAGG TAACACTGCT ATATAAGAAC AGGGTTTATT ATGATTTTAA ATTTCTCTTA
GCTAGCCCAT TGGCACATTT GAATCAGTCT TTTTTTACAT ATCTGTATCT AGCTCTGTTT TGTTGATTCT ACTATATCCC
ATGTATTTGT AAGTTGTAGT TAGTTGTGAT GCTTATGTAA AACAGTTACA CATGGGTCTT TTGTTGTTAC AGGCAGAACT
CCAGCTTAAT TTCCAGAAAA GAAGAGGTCA TGGTTTGCTG TCAGTTATCC GCCCAAAATT TAGTGGCATG CTTGGGGAAT
CACTTGATAT AGCTGCTCGA TGGAGTGGTG ATGTTGTGAG TTCTTCTTTT CATATATTCT TTTCGTGTTT GCTTTACAGT
CATGCCCCAT GTCTGGCACT TAGTAGAATA TACCGTAAGA GTGTAGTTGC AAGGGTATGG TACTCACTGT CACAATTTAT
AAGTTATTTA TGGCTTCTAG CAGACTAACT TTGCTCCGTC TCCGTGCCAT CCAAACTGCC CTGGTGTTGG GAAGTGCTGT
GATGAAGATG CTGGGCTTTA AAACACCTTG GCAAACACAA AATGGGCAAG AAAGAACTCC AGTAAATACC GTCACTGTTA
AGATGCCAGT TGGTCTGTGC AGTTAATGCC CATTCATTAG AAAGAAAATT TCTAGATTTC TAATTCACCC CATGGCTAGT
CTGTGGCACT ATGTGCATGT GTGGACTGGA GAATAGGGAG GGGAGAGGAT AGGGCAAATG ACAGGTGGAC CTGATGCTAA
CAAAAAAATT AATGAAGGCA AGGGAAATAA AGGTTACGGT TAGAATGGTC ATGTTGAACA CTTTGGACAA AAAAAGGTGA
TGGTGATGGT TTGTTTTCCA TTTTTGTTCT TTGCTATGAC GTTTTCCTAT TTACCTTTGT GATGGTATTT TGCTACTTCG
GCGGCAATTT TGGTGGCACA GAGCAAATTT ATCCTCTCTA GTATCTCCAT TGTTCTCCTT TATTTTTGAG AAAACAGATG
TATCTCCATC GTTTGTGTTT CCCAGTAGAA AATAGAAAAT AACAATGCGT CTGCATGTCC ATATGTTGTT TTTCCTGACA
TTATTTATAT ATTCTGATTT CTGAGTGAGA TTCTTATCTT CTTTTACTCA TCAGACATAA ACCACCTTTG TGCTCACTTG
AGCTATTCTT TTGTATTTTC TTTTCAACAC CCAGATTACT ATGGAAAAAT CAGTCCTAGA GCAAGCTAAT AGCAAGTATG
AACTTCAAGG GGAGTATGTT TTTCCTGGAA CACGTGATAG ATTCCCTATG GAAAGTCAGA GTAATGGTTT CATAGAGAAA
GCGATGGGAG GGCATCTTGG TAGCATGATG TCTTCGATGG GCAGGTGGAG GATGAGATTA GAAGTACCTG GTGCTGAAGT
AGCTGAAATG CTTCCGTTGG CAAGACTTCT ATCACGAAGT ACAGACCCAG CTATTCGTTC CAGATCAAAG GTGCATGCCA
TTCCCTTTGG AGGGACAAAA TATTCTGTTT ATTTGTGGTC TGTTGGAGAC TTGGATGACA GAGCCATTTT TATCCTCCTT
TTCTTTTCAG GAACTTTTTA TGCAAACTTT GCATTCTGTT GGATTCAATG CTGAAAGTCT TCGTGACCAG CTAAAGGTAC
ACTAAAGTAA ACAATCTTAT GAAAATGGAA ACAGATGCAT AGAATTGGCA TCATATATAA TGTTATATGG TTGCCTTTAT
CATTGCTGTT GTTACCATTA CCATAGGTTG CTACTTTTGT ATTAAACCTA TCCCATTGCT TGCACCAGGC ATTAGAAATG
TATCCTGATT GGTTGGATGA TGATACAATT GAGGATATAA CTCTTCCTGG CTTAGCTGAA CTGAGAGGTT ATTGGCGTGG
TTCTCTTGAT GCCAGTGGTG GAGGGAACGG CGATACTATG GTAAGCATTT CAGGCAGTAA CTATTGATAA CTCCCTTACA
GTGGTCTTTC TCTTTAGACT TTGCAAACAG TTGCACAGTG GATTGAGCAT ACAAGTATCT TTTAGCTATA TGGACCTCCC
TGCTTGTATT GTTCAACTTT ATTCACTTTG TCCCTGACAT TGTGCAGTGT TAAAGTTAGC GGTTAGTTTC CAATTCCTTT
GCATTCTTTT TTATGTCTCT TGAAGAACAA CTCTACAGAA GCTTGAAATT ACAATCAAAC TATCATCAGG ATAATCTTCC
TATACAAGAG CCAAATATAT GCCCCATATA TTTGAACTTG ATTGTAATAC TCTTATGTAC TACAGGCTGA TTTTGATTTC
AATGGTGAAG ATTGGGAGTG GGGCACTTAC AAGACACAGC GTGTTCTGGC ATCTGGTTCA TTCAGCAATA ATGATGGCCT
GCGTCTTGAT AAGTTATTTA TTCAGAAGGA TAATGCCACT CTTCATGCTG ATGGATCAAT TCTTGGCCCA TTAACAAATC
TTCACTTTGC TGTGCTTAAT TTCCCAGTTG GTCTTATACC CGCATTAGTT CAGGCTATAG AATCATCAAC CACAGACTCG
ATTCATTTTC TGAGGCAATG GTTGACACCA ATCAAAGGCA TTCTACATAT GGAGGGAGAT TTGAGAGGTA CTCTAGCAAA
GCCTGAATGT GATGTTCAAA TAAGACTTCT TGATGGCACC ATTGGAGGCA TTGATCTCGG AAGAGCTGAA GTATTAGCTT
CTGTAACCCC AACAAGCCGT TTTGTTTTTG ATGCAAACTT CGAACCGACC ATACAAAGTG GGCACGTTAA CATTCAAGGT
AGTGTTCCTG TTACTTATGT AGACAGCAAC TCCATTGAGG AAGACCTGGA AGGGGGAGAT GGTAAACAAG GTATAATAAG
AATCCCTGTT TGGGCGAAAG ACAGAGGCTT GACAAATGAC ATCAGCGAAA CAAGAATCAT GAGAGACAAG CCTGATGAGG
GTTGGGAGTT TCAATTAGCT GAAAGCCTAA AGGGTTTAAG CTGGAATATG CTAGAACCAG GCGAAGTGAG AATAAATGCA
GATATAAAGG ATGGGGGTAT GACACTGATA ACTGCACTGA GTCCTTACTC AAACTGGCTT CAAGGCTATG CTGAAGTTCT
TCTCCAGGTG CCCATTCCTA TTTAATCCCC ATAATTCCAT TAAGGAGATA TATGACTAAA TAACATAGGC TTACTCATTT
TCACCTTTTT TTCATAGCAT TAATTCAAAT TGATGAAAAT GTAAGATGAA ACTGAATTAT TAAGCATCAA GTTCAGTTTA
AATAGCTAGT TCTTTTGTTA TGCCTGTGCA CTCCAAGATG ACCTTTCCCC CCTTGTTTGT CATTTGGATG AAAGGTTAAA
GGCACTGTTG ATCACCCTGT TGTTGATGGG TCTGCCTCAT TTCACCGTGC AACCGTGGCT TCTCCTTTCC TTCGGACACC
ACTGACAAAT TTCGCTGGCA ATGTTCATGT TATATCTAAC AGACTATGTA TCAGTTCCAT GGAAAGCAGA GTTGGGAGGA
AAGGGAGATT GTCAATGAAA GGGACTCTAC CTCTCCACAA TATTGAGCCA TCAGCCAATG ACAAGATTGA ACTGAAATGC
GAAGTTCTGG ACATACGAGC AAAAAATATT TTGAGGTCAT TACCATTACT TTATCCTTTT ATATGTTGAA AGTTCTTATG
CTGCAGATTT GCTAACCTGT GGCTTGTGGG TGTTGGTGTG ATCTGGTTGA TTGTCTTCTA AAATTGTTCC TTTGATTAAA
AAAAAGTCAT ATTCCTTAGC AGAAATGTTG CTGATCTGAC ATGTCATAAA TTAAATTTGA CTGTGCAATG TGTAGGACCC
CGTATTATAT AACTTCTTAT TGTCTAATAT GCTTTCGTCT TAACTTGTGC AGTGGCCAAG TAGACAGCCA GCTGCAGGTT
ACAGGCTCAA TATTGCGGCC AGATGTCTCT GGAATGATTC GGCTAAGCCA TGGTGAAGCG TATTTGCCTC ATGATAAAGG
CAATGGTGCT GTTGCCACCA GGCTGTCTTC AAATAAATCC ATCTCTGTTC CTGCTGGTTT TGACCAAAGA ACAGTCTCAC
GAGATGTCTC CCACTTTCTA GGATCACTAT CAACTAGTCC AGACGGTAAG TAGTCATTTG TTTCGATCTT CATTAGTATT
TTAGCAAGTC CCTTTTACCA ATACATTTTG CTTAGCTTAT TAGTAGTTTC ATTTCACAGT TAGTTCCTAA CTCTTGCTAT
TACACAAAAT ATTGGAAAGC AGCATTTATT TTTTTCCTTT ACTTGTCTCT TTCTATTATT TTGTCTATTT ACTCAACAAG
TCAACTGGAT TATTCAATTT AATGTGTTAG GCCAACAATC AGAAACTGAA AGGACTCCTG AACATGGAAG TTTTAAGCCA
AACATTGATG CCCGACTCAA TGATCTGAAG CTCACATTTG GACCTGAATT AAGGATTGTT TATCCTTTAA TTTTGAATTT
TGCTGTGAGT GGCGACCTTG AGCTTAATGG CATGGTTCAT CCGAAGTACA TAAGACCTAA GGGTGTCTTA ACTTTTGAAA
ATGGTGAGGT CAATTTGGTT GCTACTCAGG TAAGCATGAG AATTCTTAAG CCCTTGTGGC ATACCTTCTT TGTCATTTTA
TATTAAATAT ACATTCTCAT GGTTACTGTG GTTTTATATT TTTATTCTTA TGCAGGTAAG ACTTAAAAAT GATCATTTGA
ATGTAGCAAA GTTTGAGCCA GATCTTGGTT TGGATCCTAT TCTGGATCTT GTTCTTGTTG GATCTGAGTG GCAATTTAAG
ATCCAAAGTC GAGCAAGCAT GTGGCAAGAC AATCTTGTTG TAACCTCCAC ACGCTCTGTG GACCAGGATG TTCTTTCACC
TAGTGAGGTA AGGCACTTTC TTCAATGAAT TGTAGCTAAG CTTTACTTTA GGTCTGATAG TTTCTTGGTT TATTTTCATC
TAGTTTTCAG AATTTTATTA CTGTATAATA AGGTGACTGC CTGGTGAACC GTTTACTGGT TGATTGCCAG CACTCTATCC
AAGACTGACA TAAAGATATT AGACAATTGG TTAATATGTG TGCTTCTCCT ATCATGCCTA ACTCTTTGAT ATTCTTTTGT
TCATTGCTGT TTCTAGGCTG CAAAGGTTTT TGAGTCACAG CTTGCGGAGT CACTATTGGA AGGTGATGGA CAGCTCGCGT
TCAAGAAACT CGCAACTGCA ACACTCGAAA CTTTGATGCC AAGGATTGAA GGCAAGGGTG AATTTGGTCA AGCACGGTGG
CGACTGGTTT ATGCACCGCA GATTCCGAGT TTACTATCTG TAGATCCAAC GGTTGACCCA CTTAAATCGC TGGCAAACAA
TATATCTTTT GCTACTGAGG TCGAAGTGCA ACTTGGAAAA CGCCTTCAGG TATTTAGCCT TTTTACATTT TTGAAAACCG
AAGCATTTTA AGCTTACTGG CATAATGTTC TGTATGAATA TCATCCGACC TGAATCGCTC ACATCGTTCT GCAGGCCTCT
GTTGTCAGGC AGATGAAAGA TTCAGAAATG GCAATGCAGT GGTCACTCAT ATATCAGCTA ACCAGCAGGC TCCGTGTTCT
CTTCCAATCT ACGCCGTCCA ATCGACTTCT CTTCGAGTAC TCTGCAACAT CCCAGGGTTG ATTCATTTTT GCCCACTACA
CAGAGCAGGA GCTGTGGAAT GGCAGCTGGT CTGTACAAAG ATGTGGCGCA CCGACACCGA TCAATTGTTC TTGTAGATAA
TGGAAGTTTT GATAGGCAGG CAGTTGTACA TGTAGACTTG CTGATGTTTT TGCTCTTTGT TGTATCTACA TTCTTTTTCT
CGGAAACAAA GTTTCTGGGT TTGTACATAG GTAGCAAATT TTAGCTCCTT TAGCTAGTTA ACGTAAGATG TAAAGAACTA
CCTGCATAAA TTATATGAAA ATTTCCAATC TCGTGGAGTC 

Locus: Os01g0179400

Loading...

Locus: Os01g0179400

Loading...