Os01t0190300-01

Locus

Os01g0190300

Description

Similar to Auxin-responsive protein IAA26 (Indoleacetic acid-induced protein 26) (Phytochrome-associated protein 1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA2

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA2

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 2, Indoleacetic Acid-Induced 2

Transcript Evidence

AK100314 (DDBJ, Best hit)

Protein Evidence

Q9LG86 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J023078N13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0190300-01)

RiceXPro (AK100314)

Others

Oryzabase (10894)

KEGG (Os01t0190300-01)

Transcript

1790 bp

>Os01t0190300-01 Similar to Auxin-responsive protein IAA26 (Indoleacetic acid-induced protein 26) (Phytochrome-associated protein 1).
TCACTCCTGCCCTTGCGAGCTTCGCACGCAGCGATCGAGAGATAGAACAGCGAGATAATG
GTAGTAGCAGCCGTTGCTTGCTTGCATTGGCTTAGCTAAGCTCAAGCTAGCTCCTACTAC
TCCTACCTGCTTCAGCTTTGCTTCCTGCGCATGAGCTAGATGCTCCCTCGCATCCATCTC
CTAGCTTTCCTTCCCTTTCTCTCGCTGCTGCTGCTGCTGCTGCATCCTCCTCTCCTGTGA
CCTGTCACAGCTTGGCCTAGGACTAGTAGGGAGTAGTGATTCTTGCTCGCTTTGTTTCTC
TGAATCCTTGCAGCTTGGCTTGGCCTTGGCCTTGGCTGCTTTGAATAGTACCTGACGGCC
TCGTGGCGCGCAAACCTTGTCCCTTTTCCCCGCAAATCCTTGCCGCCTTTTGGTCGCTCT
CTGCTCCTCCTCGTCCCTCGCGCCGTCACCACCTGCTCTGTCTCCTCTCCTTCTTGCAGC
TCGTCGTCGTCGTCGTTGATCTTTGGCTATATATTACTCCCTCCTgctgctgctgctgca
cggacgcagtgaggaggaagagCTCGTGACTTGTTTTCATCAGGAGTACAGTTGTCAGTA
GCTGATCGAGGTCGTCGTCGTCGCCATCGATGGCGTGGAGGAGAGGGTTCGGCCGGGAGG
AGGAGGACGCGGCGGCGGCGGGGGAGAGCGGCCTCGAGCTCTGCCTTGGCCTCCCCGCCT
ACTTCTCCTCCTCCTCCTCCTCCAAGCCATCGGAGGGATCAACCGCTGCTCCTGCTTTTG
CTCTCCGATCCAATGGAACCAATGCCTCCAAGCCAAGCGGGGCAGCGGCGGCGGCGCCGG
TTGTGGGGTGGCCGCCGGTGCGGTCGTTCCGGCGGAACCTCGCCTCGTCGTCGTCATCGT
CGTCCAAGCAGGCGCCGCCGCCGCCGTCGTCGTCGCCGCAGAACGGCGACAAGGCGAGCA
AAGACGGCGGCGCGGAGAAGGGCATGTTCGTGAAGATCAACATGGACGGCGTCCCGATCG
GGAGGAAGGTCGACCTCGCGGCGTACGGCGGCTACGCCCAGCTCTCCGCCGCCGTCGACA
AGCTCTTCCGCGGCCTCCTAGCCGCTCAGAGCGCTGCCGCTGACGGCGAGGCCGACGCGG
CCGCCGCCGGAGAGATGGTCGGCGGCGGCGAGTACACGCTCGTCTACGAGGACGACGAGG
GCGACCGGATGCTCGTCGGCGACGTTCCCTGGCAGATGTTCATCGCCACCGCGAAGAGGC
TGCGCGTGCTCAAGAGCTCCGACCTGCCGCCGCCGTCGCTGATGAGGGCGGCAGGGAGCA
GGAAGAGGGCAGCAGCTGACAGCTGAACTAATCACTGTCAATTTCAGCTGCTGCTGCCGA
TGATGATGAATTGATCATGGTGTGGTGCTTGGATTGAGATCCCTCTGCAGTCAAATACAC
GGTCCTTTGTCATTGACAGGTGGACCTAGGGATTATCGGGCCTATATGTTAATGATAACG
TCACATGACTTTAACTGCAGAGGATTTTGATCTGTGGTGCTTGGCTTTATGGCCATTTTG
ATGTCTTTGGGCTGCATAATTATATGTATACTTACGAGAGATCATGACGGTATTAGTGGT
CATGATTAGTAGTACGATCGAGTAGCATGGAACAGTGTTGTTAATTACTAGTAGCTGGGT
GATTAAGCTAATCTATGGCGCCTTTGGTGGTGTAATTTTGGATGTAGGCAGGCATGTGTC
AAATTAGTTATGTGTTTTGTTAATTAAGCGATCTAGTTAATGCGTTTAAG

CDS

717 bp

>Os01t0190300-01 Similar to Auxin-responsive protein IAA26 (Indoleacetic acid-induced protein 26) (Phytochrome-associated protein 1).
ATGGCGTGGAGGAGAGGGTTCGGCCGGGAGGAGGAGGACGCGGCGGCGGCGGGGGAGAGC
GGCCTCGAGCTCTGCCTTGGCCTCCCCGCCTACTTCTCCTCCTCCTCCTCCTCCAAGCCA
TCGGAGGGATCAACCGCTGCTCCTGCTTTTGCTCTCCGATCCAATGGAACCAATGCCTCC
AAGCCAAGCGGGGCAGCGGCGGCGGCGCCGGTTGTGGGGTGGCCGCCGGTGCGGTCGTTC
CGGCGGAACCTCGCCTCGTCGTCGTCATCGTCGTCCAAGCAGGCGCCGCCGCCGCCGTCG
TCGTCGCCGCAGAACGGCGACAAGGCGAGCAAAGACGGCGGCGCGGAGAAGGGCATGTTC
GTGAAGATCAACATGGACGGCGTCCCGATCGGGAGGAAGGTCGACCTCGCGGCGTACGGC
GGCTACGCCCAGCTCTCCGCCGCCGTCGACAAGCTCTTCCGCGGCCTCCTAGCCGCTCAG
AGCGCTGCCGCTGACGGCGAGGCCGACGCGGCCGCCGCCGGAGAGATGGTCGGCGGCGGC
GAGTACACGCTCGTCTACGAGGACGACGAGGGCGACCGGATGCTCGTCGGCGACGTTCCC
TGGCAGATGTTCATCGCCACCGCGAAGAGGCTGCGCGTGCTCAAGAGCTCCGACCTGCCG
CCGCCGTCGCTGATGAGGGCGGCAGGGAGCAGGAAGAGGGCAGCAGCTGACAGCTGA

Protein

239 aa

>Os01t0190300-01 Similar to Auxin-responsive protein IAA26 (Indoleacetic acid-induced protein 26) (Phytochrome-associated protein 1).
MAWRRGFGREEEDAAAAGESGLELCLGLPAYFSSSSSSKPSEGSTAAPAFALRSNGTNAS
KPSGAAAAAPVVGWPPVRSFRRNLASSSSSSSKQAPPPPSSSPQNGDKASKDGGAEKGMF
VKINMDGVPIGRKVDLAAYGGYAQLSAAVDKLFRGLLAAQSAAADGEADAAAAGEMVGGG
EYTLVYEDDEGDRMLVGDVPWQMFIATAKRLRVLKSSDLPPPSLMRAAGSRKRAAADS*

5'UTR

chr01:4816831..4817459 (+ strand) : 629 bp

CDS

chr01:4817460..4817647 (+ strand) : 188 bp

chr01:4817737..4818023 (+ strand) : 287 bp

chr01:4818121..4818250 (+ strand) : 130 bp

chr01:4818331..4818394 (+ strand) : 64 bp

chr01:4818467..4818514 (+ strand) : 48 bp

3'UTR

chr01:4818515..4818958 (+ strand) : 444 bp

FASTA

>Os01t0190300-01 class=Sequence position=chr01:4816831..4818958 (+ strand)
TCACTCCTGC CCTTGCGAGC TTCGCACGCA GCGATCGAGA GATAGAACAG CGAGATAATG GTAGTAGCAG CCGTTGCTTG
CTTGCATTGG CTTAGCTAAG CTCAAGCTAG CTCCTACTAC TCCTACCTGC TTCAGCTTTG CTTCCTGCGC ATGAGCTAGA
TGCTCCCTCG CATCCATCTC CTAGCTTTCC TTCCCTTTCT CTCGCTGCTG CTGCTGCTGC TGCATCCTCC TCTCCTGTGA
CCTGTCACAG CTTGGCCTAG GACTAGTAGG GAGTAGTGAT TCTTGCTCGC TTTGTTTCTC TGAATCCTTG CAGCTTGGCT
TGGCCTTGGC CTTGGCTGCT TTGAATAGTA CCTGACGGCC TCGTGGCGCG CAAACCTTGT CCCTTTTCCC CGCAAATCCT
TGCCGCCTTT TGGTCGCTCT CTGCTCCTCC TCGTCCCTCG CGCCGTCACC ACCTGCTCTG TCTCCTCTCC TTCTTGCAGC
TCGTCGTCGT CGTCGTTGAT CTTTGGCTAT ATATTACTCC CTCCTgctgc tgctgctgca cggacgcagt gaggaggaag
agCTCGTGAC TTGTTTTCAT CAGGAGTACA GTTGTCAGTA GCTGATCGAG GTCGTCGTCG TCGCCATCGA TGGCGTGGAG
GAGAGGGTTC GGCCGGGAGG AGGAGGACGC GGCGGCGGCG GGGGAGAGCG GCCTCGAGCT CTGCCTTGGC CTCCCCGCCT
ACTTCTCCTC CTCCTCCTCC TCCAAGCCAT CGGAGGGATC AACCGCTGCT CCTGCTTTTG CTCTCCGATC CAATGGAACC
AATGCCTCCA AGCCAAGGTT TGTTCATTTG TTCGACAGAA ATGGAGGTGG AAAGAAGCTA ATTAATTCAA TTTTGATGCT
TAATTTATGT GTGAAAATGC ATGTAGCGGG GCAGCGGCGG CGGCGCCGGT TGTGGGGTGG CCGCCGGTGC GGTCGTTCCG
GCGGAACCTC GCCTCGTCGT CGTCATCGTC GTCCAAGCAG GCGCCGCCGC CGCCGTCGTC GTCGCCGCAG AACGGCGACA
AGGCGAGCAA AGACGGCGGC GCGGAGAAGG GCATGTTCGT GAAGATCAAC ATGGACGGCG TCCCGATCGG GAGGAAGGTC
GACCTCGCGG CGTACGGCGG CTACGCCCAG CTCTCCGCCG CCGTCGACAA GCTCTTCCGC GGCCTCCTAG CCGGTGAGCT
CAGCTTTACC TTGCGCCGCC CGCCGCGTGG TGCGGTTTGC TCTTTGCTGT GACCTCATGC GAACACGATG CTATGCTATT
GCTCGTGCAG CTCAGAGCGC TGCCGCTGAC GGCGAGGCCG ACGCGGCCGC CGCCGGAGAG ATGGTCGGCG GCGGCGAGTA
CACGCTCGTC TACGAGGACG ACGAGGGCGA CCGGATGCTC GTCGGCGACG TTCCCTGGCA GTAAGTTGGA CAAAATTACA
CATCCGTAGC TAGCTTCCAT CCCAAATGAA TTTCTCGTCT CATCGATCGA TCCGCTGCAG GATGTTCATC GCCACCGCGA
AGAGGCTGCG CGTGCTCAAG AGCTCCGACC TGCCGCCGCC GTCGGTGAGC CTACCACCCA CCAACCACCA TGATCAATCA
AAATGAATTT ACTCCTGATT CGTTCTGAAT TTGCAGCTGA TGAGGGCGGC AGGGAGCAGG AAGAGGGCAG CAGCTGACAG
CTGAACTAAT CACTGTCAAT TTCAGCTGCT GCTGCCGATG ATGATGAATT GATCATGGTG TGGTGCTTGG ATTGAGATCC
CTCTGCAGTC AAATACACGG TCCTTTGTCA TTGACAGGTG GACCTAGGGA TTATCGGGCC TATATGTTAA TGATAACGTC
ACATGACTTT AACTGCAGAG GATTTTGATC TGTGGTGCTT GGCTTTATGG CCATTTTGAT GTCTTTGGGC TGCATAATTA
TATGTATACT TACGAGAGAT CATGACGGTA TTAGTGGTCA TGATTAGTAG TACGATCGAG TAGCATGGAA CAGTGTTGTT
AATTACTAGT AGCTGGGTGA TTAAGCTAAT CTATGGCGCC TTTGGTGGTG TAATTTTGGA TGTAGGCAGG CATGTGTCAA
ATTAGTTATG TGTTTTGTTA ATTAAGCGAT CTAGTTAATG CGTTTAAG

Locus: Os01g0190300

Loading...

Locus: Os01g0190300

Loading...