Os01t0190500-01

Locus

Os01g0190500

Description

IQ domain-containing protein, Homolog of GW5, Negative regulation of grain size and salt stress tolerance

RAP-DB Gene Symbol Synonym(s)

GW5L

RAP-DB Gene Name Synonym(s)

Grain Width 5-Like, GW5-Like

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK119868

Protein Evidence

Q9LG84

Literature

PMID: 30450718

Note

Manual Curation

April 1, 2021

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Domain of unknown function DUF4005 (IPR025064)

IQ motif, EF-hand binding site (IPR000048)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

002-179-B12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0190500-01)

RiceXPro (AK119868)

Others

KEGG (Os01t0190500-01)

Transcript

1833 bp

>Os01t0190500-01 IQ domain-containing protein, Homolog of GW5, Negative regulation of grain size and salt stress tolerance
GCGTTTCCCTCTCTTATTCAAACTTGACCCGTTTCGCCTTCTTGCTCAAGTGTTCGACCT
GGTCTTGGAGCGCGGCGTGTCTCTCTCGCCGGCCGGAGTCGCGAATTCCGGCCATGggca
aggcggcgaggtggttccgcagcctgtggggcggcggcggcgggaagaaggagcagggga
gagaacatgggaggacggccgcggcgccgcccccgccggacaggaagcggtggagcttcg
ccaagtcgtcgagggactcgacggagggggaggcggcggcggcggtgggagggaatgcgg
cgatcgcgaaggcggccgaggcggcgtggCTCAAGTCGATGTACAGCGACACCGAGAGGG
AGCAGAGCAAGCACGCCATCGCGGTCGCCGCGGCGACCGCGGCTGCGGCGGACGCGGCCG
TGGCGGCGGCACAGGCGGCCGTCGAGGTCGTCCGCCTCACCAGCCAGGGGCCACCCACCT
CGTCGGTGTTCGTCTGCGGCGGCGTCTTGGATCCCCGTGGCCGCGCCGCCGCGGTCAAGA
TCCAGACAGCCTTCCGAGGATTCTTGGCGAAGAAGGCGCTGCGAGCGCTCAAGGCGCTGG
TGAAGCTGCAGGCGCTGGTGCGCGGCTACCTGGTGAGGCGGCAGGCGGCGGCGACGCTGC
AGAGCATGCAGGCGCTCGTCCGCGCGCAGGCCGCCGTCCGCGCCGCGCGCTCGTCGCGCG
GCGCCGCGCTGCCGCCGCTGCACCTCCACCACCACCCTCCCGTCCGGCCGCGCTATTCCC
TGCAAGAGCGGTATATGGACGACACGAGGAGCGAGCATGGCGTGGCGGCGTACAGCCGCC
GCCTGTCGGCGAGCATCGAGTCGTCGTCGTACGGGTACGACCGGAGCCCCAAGATCGTGG
AGATGGACACCGGGCGGCCCAAGTCGAGGTCGTCGTCGGTCAGGACGAGCCCTCCCGTGG
TCGACGCCGGCGCCGCCGAGGAGTGGTACGCCAACTCGGTGTCGTCGCCGCTCCTCCCGT
TCCACCAGCTCCCCGGCGCGCCGCCGCGGATATCGGCGCCGAGCGCACGCCACTTCCCGG
AGTACGACTGGTGCCCGCTCGAGAAGCCCAGGCCGGCGACGGCGCAGAGCACGCCGCGGC
TTGCGCACATGCCGGTGACGCCGACGAAGAGCGTCTGCGGCGGCGGCGGCTACGGCGCGT
CGCCCAACTGCCGCGGCTACATGTCGAGCACGCAATCGTCGGAGGCGAAGGTGCGGTCCC
AGAGCGCGCCGAAGCAGCGGCCGGAGCCGGGCGTCGCCGGCGGCACCGGCGGCGGCGCGC
GGAAGAGGGTGCCGCTGAGCGAGGTGACCCTGGAGGCGAGGGCGAGCCTGAGCGGCGTGG
GCATGCAGCGCTCGTGCAACCGTGTCCAGGAGGCGTTCAACTTCAAGACCGCCGTGCTCA
GCCGCTTCGACCGCTCGTCGGAGCCGGCCGCCGAGAGGGACCGCGACCTCTTCTTGCAGA
GGAGGTGGTGATCTGAACAGCGTTCGCCATTGCAAGAAGGAAGAGGACTACAAGAACTAG
TTCTTCTTCTTCTTCTTAGTCTCTGTTTCTATGCGACATAGTAGCGATCGATCATGTTTG
ATCGATGGCAATGGCGATCGTGTGCTCCGCCATTGCCGTCGTCTCCGAGCTTGTTACTGA
CAAGTGACAGGCAAAGTGTACGTTGAGCTAGCTGGAGGGGAGATTACAAAAAAAAAAAAT
CCCACTTCTTTCCCCTCTGATTTAACAGTGCACTTGGATGTACATTCCCCTATCAATTCA
AGGCCAGCAAATCAAATCCCGTTGTTTTTTTTT

CDS

1398 bp

>Os01t0190500-01 IQ domain-containing protein, Homolog of GW5, Negative regulation of grain size and salt stress tolerance
ATGggcaaggcggcgaggtggttccgcagcctgtggggcggcggcggcgggaagaaggag
caggggagagaacatgggaggacggccgcggcgccgcccccgccggacaggaagcggtgg
agcttcgccaagtcgtcgagggactcgacggagggggaggcggcggcggcggtgggaggg
aatgcggcgatcgcgaaggcggccgaggcggcgtggCTCAAGTCGATGTACAGCGACACC
GAGAGGGAGCAGAGCAAGCACGCCATCGCGGTCGCCGCGGCGACCGCGGCTGCGGCGGAC
GCGGCCGTGGCGGCGGCACAGGCGGCCGTCGAGGTCGTCCGCCTCACCAGCCAGGGGCCA
CCCACCTCGTCGGTGTTCGTCTGCGGCGGCGTCTTGGATCCCCGTGGCCGCGCCGCCGCG
GTCAAGATCCAGACAGCCTTCCGAGGATTCTTGGCGAAGAAGGCGCTGCGAGCGCTCAAG
GCGCTGGTGAAGCTGCAGGCGCTGGTGCGCGGCTACCTGGTGAGGCGGCAGGCGGCGGCG
ACGCTGCAGAGCATGCAGGCGCTCGTCCGCGCGCAGGCCGCCGTCCGCGCCGCGCGCTCG
TCGCGCGGCGCCGCGCTGCCGCCGCTGCACCTCCACCACCACCCTCCCGTCCGGCCGCGC
TATTCCCTGCAAGAGCGGTATATGGACGACACGAGGAGCGAGCATGGCGTGGCGGCGTAC
AGCCGCCGCCTGTCGGCGAGCATCGAGTCGTCGTCGTACGGGTACGACCGGAGCCCCAAG
ATCGTGGAGATGGACACCGGGCGGCCCAAGTCGAGGTCGTCGTCGGTCAGGACGAGCCCT
CCCGTGGTCGACGCCGGCGCCGCCGAGGAGTGGTACGCCAACTCGGTGTCGTCGCCGCTC
CTCCCGTTCCACCAGCTCCCCGGCGCGCCGCCGCGGATATCGGCGCCGAGCGCACGCCAC
TTCCCGGAGTACGACTGGTGCCCGCTCGAGAAGCCCAGGCCGGCGACGGCGCAGAGCACG
CCGCGGCTTGCGCACATGCCGGTGACGCCGACGAAGAGCGTCTGCGGCGGCGGCGGCTAC
GGCGCGTCGCCCAACTGCCGCGGCTACATGTCGAGCACGCAATCGTCGGAGGCGAAGGTG
CGGTCCCAGAGCGCGCCGAAGCAGCGGCCGGAGCCGGGCGTCGCCGGCGGCACCGGCGGC
GGCGCGCGGAAGAGGGTGCCGCTGAGCGAGGTGACCCTGGAGGCGAGGGCGAGCCTGAGC
GGCGTGGGCATGCAGCGCTCGTGCAACCGTGTCCAGGAGGCGTTCAACTTCAAGACCGCC
GTGCTCAGCCGCTTCGACCGCTCGTCGGAGCCGGCCGCCGAGAGGGACCGCGACCTCTTC
TTGCAGAGGAGGTGGTGA

Protein

466 aa

>Os01t0190500-01 IQ domain-containing protein, Homolog of GW5, Negative regulation of grain size and salt stress tolerance
MGKAARWFRSLWGGGGGKKEQGREHGRTAAAPPPPDRKRWSFAKSSRDSTEGEAAAAVGG
NAAIAKAAEAAWLKSMYSDTEREQSKHAIAVAAATAAAADAAVAAAQAAVEVVRLTSQGP
PTSSVFVCGGVLDPRGRAAAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAA
TLQSMQALVRAQAAVRAARSSRGAALPPLHLHHHPPVRPRYSLQERYMDDTRSEHGVAAY
SRRLSASIESSSYGYDRSPKIVEMDTGRPKSRSSSVRTSPPVVDAGAAEEWYANSVSSPL
LPFHQLPGAPPRISAPSARHFPEYDWCPLEKPRPATAQSTPRLAHMPVTPTKSVCGGGGY
GASPNCRGYMSSTQSSEAKVRSQSAPKQRPEPGVAGGTGGGARKRVPLSEVTLEARASLS
GVGMQRSCNRVQEAFNFKTAVLSRFDRSSEPAAERDRDLFLQRRW*

5'UTR

chr01:4826590..4826702 (+ strand) : 113 bp

CDS

chr01:4826703..4827155 (+ strand) : 453 bp

chr01:4827344..4827559 (+ strand) : 216 bp

chr01:4827683..4828411 (+ strand) : 729 bp

3'UTR

chr01:4828412..4828733 (+ strand) : 322 bp

FASTA

>Os01t0190500-01 class=Sequence position=chr01:4826590..4828733 (+ strand)
GCGTTTCCCT CTCTTATTCA AACTTGACCC GTTTCGCCTT CTTGCTCAAG TGTTCGACCT GGTCTTGGAG CGCGGCGTGT
CTCTCTCGCC GGCCGGAGTC GCGAATTCCG GCCATGggca aggcggcgag gtggttccgc agcctgtggg gcggcggcgg
cgggaagaag gagcagggga gagaacatgg gaggacggcc gcggcgccgc ccccgccgga caggaagcgg tggagcttcg
ccaagtcgtc gagggactcg acggaggggg aggcggcggc ggcggtggga gggaatgcgg cgatcgcgaa ggcggccgag
gcggcgtggC TCAAGTCGAT GTACAGCGAC ACCGAGAGGG AGCAGAGCAA GCACGCCATC GCGGTCGCCG CGGCGACCGC
GGCTGCGGCG GACGCGGCCG TGGCGGCGGC ACAGGCGGCC GTCGAGGTCG TCCGCCTCAC CAGCCAGGGG CCACCCACCT
CGTCGGTGTT CGTCTGCGGC GGCGTCTTGG ATCCCCGTGG CCGCGCCGCC GCGGTCAAGA TCCAGACAGC CTTCCGAGGA
TTCTTGGTGA GTGAGCCCCA ACAACTTCCT CACTTCTTCC AAGAACAACA GTGTCTGCTT CTGTTCTTGA TCTGTTCGTC
TTCTTTGGCG ACGTGCTCAT TTCGATTTCA TCCACTGTTC CAGTAGATTT CCTTTTCCAA AAAAAGCTCA TAGATTAAGA
CATGATTAGA TTTTTATTTT TGTTCTTGGT TCAGGCGAAG AAGGCGCTGC GAGCGCTCAA GGCGCTGGTG AAGCTGCAGG
CGCTGGTGCG CGGCTACCTG GTGAGGCGGC AGGCGGCGGC GACGCTGCAG AGCATGCAGG CGCTCGTCCG CGCGCAGGCC
GCCGTCCGCG CCGCGCGCTC GTCGCGCGGC GCCGCGCTGC CGCCGCTGCA CCTCCACCAC CACCCTCCCG TCCGGCCGCG
CTATTCCCTG GTACGAGTAC GACCACGATC GCTTGCGTGC GAAGCGGGCG AGCTTTTTTT TTAAAGGTGT TCGTCCGAGG
CATGTTGGTT GCTGTGACAC AATTCTTACC TCGGGGGTTT CTTGTGTTTG CAGCAAGAGC GGTATATGGA CGACACGAGG
AGCGAGCATG GCGTGGCGGC GTACAGCCGC CGCCTGTCGG CGAGCATCGA GTCGTCGTCG TACGGGTACG ACCGGAGCCC
CAAGATCGTG GAGATGGACA CCGGGCGGCC CAAGTCGAGG TCGTCGTCGG TCAGGACGAG CCCTCCCGTG GTCGACGCCG
GCGCCGCCGA GGAGTGGTAC GCCAACTCGG TGTCGTCGCC GCTCCTCCCG TTCCACCAGC TCCCCGGCGC GCCGCCGCGG
ATATCGGCGC CGAGCGCACG CCACTTCCCG GAGTACGACT GGTGCCCGCT CGAGAAGCCC AGGCCGGCGA CGGCGCAGAG
CACGCCGCGG CTTGCGCACA TGCCGGTGAC GCCGACGAAG AGCGTCTGCG GCGGCGGCGG CTACGGCGCG TCGCCCAACT
GCCGCGGCTA CATGTCGAGC ACGCAATCGT CGGAGGCGAA GGTGCGGTCC CAGAGCGCGC CGAAGCAGCG GCCGGAGCCG
GGCGTCGCCG GCGGCACCGG CGGCGGCGCG CGGAAGAGGG TGCCGCTGAG CGAGGTGACC CTGGAGGCGA GGGCGAGCCT
GAGCGGCGTG GGCATGCAGC GCTCGTGCAA CCGTGTCCAG GAGGCGTTCA ACTTCAAGAC CGCCGTGCTC AGCCGCTTCG
ACCGCTCGTC GGAGCCGGCC GCCGAGAGGG ACCGCGACCT CTTCTTGCAG AGGAGGTGGT GATCTGAACA GCGTTCGCCA
TTGCAAGAAG GAAGAGGACT ACAAGAACTA GTTCTTCTTC TTCTTCTTAG TCTCTGTTTC TATGCGACAT AGTAGCGATC
GATCATGTTT GATCGATGGC AATGGCGATC GTGTGCTCCG CCATTGCCGT CGTCTCCGAG CTTGTTACTG ACAAGTGACA
GGCAAAGTGT ACGTTGAGCT AGCTGGAGGG GAGATTACAA AAAAAAAAAA TCCCACTTCT TTCCCCTCTG ATTTAACAGT
GCACTTGGAT GTACATTCCC CTATCAATTC AAGGCCAGCA AATCAAATCC CGTTGTTTTT TTTT

Locus: Os01g0190500

Loading...

Locus: Os01g0190500

Loading...