Os01t0191300-02

Locus

Os01g0191300

Description

Similar to NAC-type transcription factor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ONAC003, ONAC3, ONAC016, ONAC16, SNAC3, OsSND3, SND3, OsNAC006, NAC006

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 003, NAC domain-containing protein 3, NAC domain-containing protein 16, stress-responsive NAC transcription factor 3, SECONDARY WALL-ASSOCIATED NAC PROTEIN3

Transcript Evidence

AK066231 (DDBJ, Best hit)

Protein Evidence

B2CPX4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 6, 2016

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013059M09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0191300-02)

Others

Oryzabase (11455)

KEGG (Os01t0191300-02)

Transcript

2242 bp

>Os01t0191300-02 Similar to NAC-type transcription factor.
GTTTGCTCTTCTACTGCTCATCCTCCTCCTCTACTACTCGTCCTCTTTGCTCTATTCACA
GCTAGCAACAAGAAGGAGGCTTACACATGCATGTGCACGGTCTCTGCCGGACGCATATGA
ATCAGGCATGAATAGGGGGCACATCAGCAGCTCGGAGCTCATCGACGCCAAGCTCGAGGA
ACGCCGGATCTCCACGGCCAAGCACTGCCCCAGCTGCGGCAACAAGCTCGACTGCAAACC
GGATTGGGTGGGGCTACCGGCAGGAGTCAAGTTCGATCCGACGGACCAGGAGTTGATCGA
GCACCTCGAGGCCAAAGTGAGGGAAGAAGGCTCAAGATCTCATCCTCTCATCGATGAGTT
CATACCCACGATAGAAGGGGAGGACGGCATATGCTACACCCACCCTGAGAAACTTCCAGG
TGAGAGTGAGAGAGCTAAGGTAGCTATAGCTCAAAACATTGCACCCCCCGCATTGTTTTG
ATACAGATATATTCCTGGCTTTTTGCAAAACTTTATCGGGTTTTTTTTGCTTTCCATGGA
GTGATATATATTGTATGCTGGGATTGTTTCGCCATGAATTATGGGTCGTGGTTTTGGATT
TTGGGATATGGCATATATTCCCTTGTTGTTCTTGATGTGCTCTCCCCCCTCTCTATTCTT
ATTACTAGTGTTTCTCTACATGTGCTCTTGGCCGGTATATGCAAAGAGAATTATTGTTTA
TGGAAAGTTGTGCCTAGTCTCATCTCCCACTCTCTCCTCTCTGTCATGATGGTAAGATGC
TTCTGAAGTTTCCAAATAGGTTTCTTTCCTCTCTTCCTCTTTTTCAGAGAGGTTTGTTGC
ATCTGTCAAGAAGCATAGGCCACCCACTCCACACTATACTCTTGGATCTCACAAAACTCT
CTATACTACCTTGATCCTGCTAATTATTCTGTTTGTGCTGATCGATCGATGGAGCAGGTG
TGACAAGGGACGGCCTGAGCAAGCACTTCTTCCACCGGCCGTCGAAGGCGTACACGACGG
GGACGAGGAAGCGGCGGAAGATCCAGACGGAGTGCGACGTGCAGAAGGGGGAGACGAGGT
GGCACAAGACCGGCAAGACCCGGCCGGTGATGGTGAGCGGCCGGCAGAAGGGGTGCAAGA
AGATACTGGTCCTCTACACCAACTTCGGCAAGCACCGCAAGCCGGAGAAGACCAACTGGG
TGATGCACCAGTACCACCTCGGCGACCTCGAGGAGGAGAAGGAAGGGGAGCTCGTCGTCT
GCAAGATCTTCTACCAGACGCAGCCTCGGCAGTGCAGCTGGTCCTCCGACCgcggcggcg
gcgccgccgccaccgcatccgccgtgacgacggcggcggtgcagcaggatcagcagcgca
ggagggacagcggcagcggcagctgctcgtcgacgagggaccacgaggtgtcggcgacgt
cctactcgacggccgggtacgccgtcgccgccgccgtcgAGATGCAGCATTTGAAGCATG
CCGCCGACCATTTCAGCTTCGCGCCTTTCAGGAAGAGTTTCGAGGAGGTTGGTATAAGTG
GTGATCAGGTACACTCCAATCAGCTTGGGAGGTCGGAGCAGCAGCATGCTGGCCAGGAAC
AACAGCCGCACCGGCCGTTGCTTGCAACCACGACGGCGGTGCCTGCCACGGCCTTCCTGA
TCAGCCGGCCGACGAACCCTGTATCAAATATAGTGCCACCAGCAATGCAGCATGCATCTG
TCGTTCTTGATCATGATCAGTTCCACGTGCCAGCAATCCTTCTCCACCACGACAAATTTC
AGCAGCAGCAACAAAAGCTTGACAGGAGGTCTGCCGGCTTGGAGGAACTGATAATGGGCT
GCACGTCTTCGAGCACAAAAGGAGAAGCTTCAATTCCTCACTCCCAAGAGACAGAATGGC
CTTACCAGCCATACTGGACTCCTGACAACCAGGATCATCATGGATAGTAGCAACAAGGCT
GGTAAATAGTGAAGATCAATACCAAAAGAAAACTAACCACATTCTCTTTCACCTTGTGTG
GTCTCTGTCTTCTTGAATATACAACATTGCTTTCTTGAAGAATGTATGTACTACGGTTGG
GAGAAGAAATAGATTAAAGAGATCTGTATAGATCTGCCTCCATGAAAAAAGGGAGATCAA
ATTAACTGTGCAAGGACACTCCAAGATAGAAGAGACAAAGTTGTTGAAAGAAAAGAAAAG
AGAGGACAAAAAAAGTTTGGGC

CDS

858 bp

>Os01t0191300-02 Similar to NAC-type transcription factor.
ATGGTGAGCGGCCGGCAGAAGGGGTGCAAGAAGATACTGGTCCTCTACACCAACTTCGGC
AAGCACCGCAAGCCGGAGAAGACCAACTGGGTGATGCACCAGTACCACCTCGGCGACCTC
GAGGAGGAGAAGGAAGGGGAGCTCGTCGTCTGCAAGATCTTCTACCAGACGCAGCCTCGG
CAGTGCAGCTGGTCCTCCGACCgcggcggcggcgccgccgccaccgcatccgccgtgacg
acggcggcggtgcagcaggatcagcagcgcaggagggacagcggcagcggcagctgctcg
tcgacgagggaccacgaggtgtcggcgacgtcctactcgacggccgggtacgccgtcgcc
gccgccgtcgAGATGCAGCATTTGAAGCATGCCGCCGACCATTTCAGCTTCGCGCCTTTC
AGGAAGAGTTTCGAGGAGGTTGGTATAAGTGGTGATCAGGTACACTCCAATCAGCTTGGG
AGGTCGGAGCAGCAGCATGCTGGCCAGGAACAACAGCCGCACCGGCCGTTGCTTGCAACC
ACGACGGCGGTGCCTGCCACGGCCTTCCTGATCAGCCGGCCGACGAACCCTGTATCAAAT
ATAGTGCCACCAGCAATGCAGCATGCATCTGTCGTTCTTGATCATGATCAGTTCCACGTG
CCAGCAATCCTTCTCCACCACGACAAATTTCAGCAGCAGCAACAAAAGCTTGACAGGAGG
TCTGCCGGCTTGGAGGAACTGATAATGGGCTGCACGTCTTCGAGCACAAAAGGAGAAGCT
TCAATTCCTCACTCCCAAGAGACAGAATGGCCTTACCAGCCATACTGGACTCCTGACAAC
CAGGATCATCATGGATAG

Protein

286 aa

>Os01t0191300-02 Similar to NAC-type transcription factor.
MVSGRQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGDLEEEKEGELVVCKIFYQTQPR
QCSWSSDRGGGAAATASAVTTAAVQQDQQRRRDSGSGSCSSTRDHEVSATSYSTAGYAVA
AAVEMQHLKHAADHFSFAPFRKSFEEVGISGDQVHSNQLGRSEQQHAGQEQQPHRPLLAT
TTAVPATAFLISRPTNPVSNIVPPAMQHASVVLDHDQFHVPAILLHHDKFQQQQQKLDRR
SAGLEELIMGCTSSSTKGEASIPHSQETEWPYQPYWTPDNQDHHG*

5'UTR

chr01:4885792..4885840 (- strand) : 49 bp

chr01:4885484..4885675 (- strand) : 192 bp

chr01:4884464..4885331 (- strand) : 868 bp

CDS

chr01:4884026..4884463 (- strand) : 438 bp

chr01:4883011..4883265 (- strand) : 255 bp

chr01:4881888..4881968 (- strand) : 81 bp

chr01:4880148..4880231 (- strand) : 84 bp

3'UTR

chr01:4879873..4880147 (- strand) : 275 bp

FASTA

>Os01t0191300-02 class=Sequence position=chr01:4879873..4885840 (- strand)
GTTTGCTCTT CTACTGCTCA TCCTCCTCCT CTACTACTCG TCCTCTTTGG TTTGCTTCCG GCCTCTTCTT CCTGCATAGC
TTCTGTTATT CGATTTCGAT GATCTTGTCT TCTCCTTGAA TTGTGTGTGT ATTAATTAAC TGTATGTTTG TTTGATCCCT
TGCAGCTCTA TTCACAGCTA GCAACAAGAA GGAGGCTTAC ACATGCATGT GCACGGTCTC TGCCGGACGC ATATGAATCA
GGCATGAATA GGGGGCACAT CAGCAGCTCG GAGCTCATCG ACGCCAAGCT CGAGGAACGC CGGATCTCCA CGGCCAAGCA
CTGCCCCAGC TGCGGCAACA AGCTCGACTG CAAACCGGTA TGTGAAGAGT GAAGTGATCA ACTTCGTTTT GCCTAGCTCT
TTTCAGTAAT TGCACACTTG CACCTCGGTC GGTAGCGAGG GTTCTTGGGC TTCTTGCTGC CTGGTGCAAA ACTTGTTCTT
ATGGAATTAA TTGGTGTAAC TGCAAGAAGG ATTGGGTGGG GCTACCGGCA GGAGTCAAGT TCGATCCGAC GGACCAGGAG
TTGATCGAGC ACCTCGAGGC CAAAGTGAGG GAAGAAGGCT CAAGATCTCA TCCTCTCATC GATGAGTTCA TACCCACGAT
AGAAGGGGAG GACGGCATAT GCTACACCCA CCCTGAGAAA CTTCCAGGTG AGAGTGAGAG AGCTAAGGTA GCTATAGCTC
AAAACATTGC ACCCCCCGCA TTGTTTTGAT ACAGATATAT TCCTGGCTTT TTGCAAAACT TTATCGGGTT TTTTTTGCTT
TCCATGGAGT GATATATATT GTATGCTGGG ATTGTTTCGC CATGAATTAT GGGTCGTGGT TTTGGATTTT GGGATATGGC
ATATATTCCC TTGTTGTTCT TGATGTGCTC TCCCCCCTCT CTATTCTTAT TACTAGTGTT TCTCTACATG TGCTCTTGGC
CGGTATATGC AAAGAGAATT ATTGTTTATG GAAAGTTGTG CCTAGTCTCA TCTCCCACTC TCTCCTCTCT GTCATGATGG
TAAGATGCTT CTGAAGTTTC CAAATAGGTT TCTTTCCTCT CTTCCTCTTT TTCAGAGAGG TTTGTTGCAT CTGTCAAGAA
GCATAGGCCA CCCACTCCAC ACTATACTCT TGGATCTCAC AAAACTCTCT ATACTACCTT GATCCTGCTA ATTATTCTGT
TTGTGCTGAT CGATCGATGG AGCAGGTGTG ACAAGGGACG GCCTGAGCAA GCACTTCTTC CACCGGCCGT CGAAGGCGTA
CACGACGGGG ACGAGGAAGC GGCGGAAGAT CCAGACGGAG TGCGACGTGC AGAAGGGGGA GACGAGGTGG CACAAGACCG
GCAAGACCCG GCCGGTGATG GTGAGCGGCC GGCAGAAGGG GTGCAAGAAG ATACTGGTCC TCTACACCAA CTTCGGCAAG
CACCGCAAGC CGGAGAAGAC CAACTGGGTG ATGCACCAGT ACCACCTCGG CGACCTCGAG GAGGAGAAGG AAGGGGAGCT
CGTCGTCTGC AAGATCTTCT ACCAGACGCA GCCTCGGCAG TGCAGCTGGT CCTCCGACCg cggcggcggc gccgccgcca
ccgcatccgc cgtgacgacg gcggcggtgc agcaggatca gcagcgcagg agggacagcg gcagcggcag ctgctcgtcg
acgagggacc acgaggtgtc ggcgacgtcc tactcgacgg ccgggtacgc cgtcgccgcc gccgtcgAGA TGCAGCATTT
GAAGCATGCC GCCGACCATT TCAGCTTCGC GCCTTTCAGG AAGAGTTTCG AGGAGGTAAT TAATTTAATT ACCACTTGTT
ACATGCATAC TGCCACTTTT CTGTATACAT ACTGTATGAA TCTTTGATCA GTTTTCGGAG TAATGCTGGT TAGGTTACGC
ATCCTAATCA GTTTCTCTCC AAGTAAACTG CTGGTTAGGT TCTGTGCCGT TTTCTGCATG CATCTTAATC AGTGCACGTC
ATGCAGATCA TGCAAATTAA CCATGGTCCA TATTCCCATG CACGCATGCA TGGATATATA TACACTCGCT CGCATGGATA
TATACTGACT TTCTGTTTTT CTAGGTGCAG ATTGGGATAC ATATACTTTC TGTTTGATTA GATGAGCTTC CTTCAATTTG
TTGCGTATGG ATGAGCGGTT TGGGGCGGGG TAGCTGACCA AATGTGTAGG ATGCGCCAAT TTAAAGCAAA AGATGAGCTA
CACATCACAC AGCAGCATGG ACCCTTTTAG TTCGAGCCTC ACATCATTTT ACTCAGATTG CAAGCAACCC TAAAACCATC
CACGATCCAC CCACCGTGAA AGCAAAAACT AGTAATATAT ATAATTGGCC CGGTCTCATT CTTTCAATTA TTCCAACCAA
AAAATGTATA TTTCAAGAAA GTTCAAATAA TATACATACT ACTGTAACAT ACATACTAAC TGAAAGGGAG TGATAAAAGA
CAAATATAAT GGGAACATTA TGCATGTATG TTAGTTTTAT AAAAAACATT ATGCATGCAT GACATGGAAT TTTTCCATTT
GTTTGCATCA AACAGGTTGG TATAAGTGGT GATCAGGTAC ACTCCAATCA GCTTGGGAGG TCGGAGCAGC AGCATGCTGG
CCAGGAACAA CAGCCGCACC GGCCGTTGCT TGCAACCACG ACGGCGGTGC CTGCCACGGC CTTCCTGATC AGCCGGCCGA
CGAACCCTGT ATCAAATATA GTGCCACCAG CAATGCAGCA TGCATCTGTC GTTCTTGATC ATGATCAGTT CCACGTGCCA
GCAATCCTTC TCCACCACGA CAAATTTCAG GTGTGATTTC ATCTCATCTT ATACATTTTC TCCTCAAATA AAACATTTCC
ATTATCTAAA ATAATTCCCT AAAATTAATA CTAATTTCTC TTTTTCTAGC AGCTGGGTAA TAGATTGGGC ACGGTAGCTG
TTGAAAAAAA AACTATAGGA ACACATATAT GCATGCATTT ATGAAGAATA TTCTTTACAT ATTCAGAATG TTAAATTTAA
GTAAGGAGTA ACAAACCATC TCCAACAAAA AACAATTTCA GCTTGAAAAC AAGCAATGGA CTCGCTAGGC AGTACATTTC
ATACTTCCCA TCTAGACAAA CTTAATTAGT ACGGCTTGGT CTAAAGTCCA CATTTTCCTC CTTCAAGCTA AGAGTTTCTT
GCTATCATAG GATCCCTTTG AATTCTCTAA AAATAAACTA AAAACCATTC TCAGCTTTCA ATTTCAATAA AAAGAATCAA
GGATTTGTGA TAATCTTAAG TGTCAAAATT AGTCATTTTT AGTTGGTCAT ACTAAACATA TTGGGCAATA ATTTATACAA
ATAATTGTGA TATACAAAAT ATTAAAAAAA ATTCTAGTTA TGGCACTTCT AATGTTGATT TGTACATATG TAGGGTTTTT
CAAGTCGTGT AATTACTATT TGATATGAAC TATGTTTTTT TATATATATA CCAAGGAAGT TGCATATGGA TGAAATTAAG
CTGTCTGAAG ATGCATTTTC TAGACTATAA ATATAGAGCC TAGACAATTC TGGAAGGATT CTTTGTTTAC CCATATATAT
ATGTGTAATC TGGTAATGAA TCTGCTTTGT ATTTCCACCG TTCCTATATA TATGTATCAC TTTAGGTAAA TCTATATACA
ATTGAACTGT TTATTTCATA TATATCAAGA TACTAATGCA TTGTCTCAGC TCATTCTTCA TCTCTTTGGT GATTTACTTA
ATTATATTAT TGTAGCTCCT TTACTTTTTT TTTTCGTTTT GCTCTTTACT AAAGAATGCT TTAGCTACTG TTCTATCCCA
ACATAATTAA CAACGAACAT GCAACACAGC AGCAGCAGCA ACAAAAGCTT GACAGGAGGT CTGCCGGCTT GGAGGAACTG
ATAATGGGCT GCACGTCTTC GAGCACAAAA GGAGTAAGTT TCTCTTGCAT TTTTATTTGA TTGCCTCCTC AGCATGGATC
CAAGCCGATA ATTTACCAGT CAGAGGCTCT ACGCATGCAG TAAAGCATTC CTGCACATAT CCAATTGGAA TTAATATATA
TGCATGTACG TAGCAATTGC ATGTGAGACG CATGCATGTG TCCCTTTTAA ACGGTTTTAA TCTGAACATT AGCTCAGGCC
AAATTTAATA TAATTGTAGT TATTTATATA TACTGATTTA AACATATAAT ACATGGGTGG GAAAGCTGCA AGCTATGTCT
TATAGGCGAG GTGAGGGGTT TAGAAAAGAA AGACTGCTCA GGAGGGTCCT GAGGAAACTT CAGTGTGGGG CCTCATAGTT
TCTTTGTCGT CCTAGCCAGC ACTTTGAAAC AGGCCCTTCA CCTTGACAGC TTTTTCCTCT CATTTGTTTC CCTATTTTTA
AATTCGCCAT TTTAGGTGTG CTTTTACAGC AAGCATGCCG ACGAGAGAGA GAGAGAGAGA AATCTTCAGT ACTCCTAGTG
AGATAGTAGA TAGAAGAAAC ATCATGAATA TATGCAAACA AGGACCACCC TTTGCTTTGC TTTTGAGTGC CAAAGGGGGA
GAGCCAAAGA CCAGCGTAAA AACAAGACCA TACTTTCCTT GCTTTCATGA CCGTATAGGT GAAAACGAGA GCTTTCTCTC
CATGTCAGTA GCCCCTCTCC TCGCTTTTCT GACTGTATGG CTATAAGAAT AGTTGTTTAC TGTTATCTCT TGCGAAAAGA
GCAAAAGAAA AGGAGGAAAT ATTATTCGTT TCTTGCTCTC TTTTGTCTCT TTTCTATGAA ATGAATTCAC ACTGACACCA
TGCATGAGGA TAAGAGAATC ATTATTGTGA AATTTGTTTG CATTAATCGT TGTGAACTTG TTCTTGTATT ACATTACTAA
AAATTAAAAT CTTGACATTT ACAAGGTAGT ATATACATGC ACGTTCAGGT AATATAGAAC AAAAGTGTAC TTATTTTTGT
CAAAACTCCA TTGGATGATT AGACATGAGt agtacatccg tctcaaaata taataacttt tagctacgaa tttaaacaag
agtatgtcta gattcgtagt caataattgc tatattttcg aacagatcaa ggtagtaATG ATATGTGTAT TGCATAGTTA
TTCAATGAGA TCGTTCTTTG ACACGTTGGC CTCATTAATA ATATGGTGCA ATGCGTTATA TTGGAGATCA ATCATTCTGA
CCCCGACTAT ATACTCCGTA TAAGTAAGTG ACAAAAAGAG TTATGCCTTA CTACTTTTCC CCTCCTTTGT TTTCGCGTTG
AATTATATGG GAGATTAATT AATAAAGTAC TGTGACAACA CAACTATAGT ACTACTAGTC TACTACCGTG GTATCTGCTA
TATCTCTCAC AAGAGATCCG AATTGGCTAC CTTGATATTA TTTAAATGAA CATTTCTGGT ATCATCTGGA GTGTAAATAA
GAGCAAGTAC TATAAAACTT GCTCTAAGGT AGTCCGTACT TGAACAGTTG AAAATTTTGA ATTATTTCCC TACTGACATT
TTAAAGTGAT ACCGTATCTT TCTTATTCAA CTGTTGCACT TCACTGAGCT GTTCTTTTTT GACCCCCCCT TTTCCATATT
CTATTGCAGG AAGCTTCAAT TCCTCACTCC CAAGAGACAG AATGGCCTTA CCAGCCATAC TGGACTCCTG ACAACCAGGA
TCATCATGGA TAGTAGCAAC AAGGCTGGTA AATAGTGAAG ATCAATACCA AAAGAAAACT AACCACATTC TCTTTCACCT
TGTGTGGTCT CTGTCTTCTT GAATATACAA CATTGCTTTC TTGAAGAATG TATGTACTAC GGTTGGGAGA AGAAATAGAT
TAAAGAGATC TGTATAGATC TGCCTCCATG AAAAAAGGGA GATCAAATTA ACTGTGCAAG GACACTCCAA GATAGAAGAG
ACAAAGTTGT TGAAAGAAAA GAAAAGAGAG GACAAAAAAA GTTTGGGC

Locus: Os01g0191300

Loading...

Locus: Os01g0191300

Loading...