Os01t0191300-03

Locus

Os01g0191300

Description

NAC transcription factor, Drought resistance

RAP-DB Gene Symbol Synonym(s)

OsNAC006

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ONAC003, ONAC3, ONAC016, ONAC16, SNAC3, OsSND3, SND3, OsNAC006, NAC006

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 003, NAC domain-containing protein 3, NAC domain-containing protein 16, stress-responsive NAC transcription factor 3, SECONDARY WALL-ASSOCIATED NAC PROTEIN3

Transcript Evidence

AK121339

Protein Evidence

B7F736

Literature

PMID: 32225072

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

April 3, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain superfamily (IPR036093)

NAC domain (IPR003441)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023120G13 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0191300-03)

Others

Oryzabase (11455)

Transcript

5597 bp

>Os01t0191300-03 NAC transcription factor, Drought resistance
TTTGCTCTTCTACTGCTCATCCTCCTCCTCTACTACTCGTCCTCTTTGCTCTATTCACAG
CTAGCAACAAGAAGGAGGCTTACACATGCATGTGCACGGTCTCTGCCGGACGCATATGAA
TCAGGCATGAATAGGGGGCACATCAGCAGCTCGGAGCTCATCGACGCCAAGCTCGAGGAA
CGCCGGATCTCCACGGCCAAGCACTGCCCCAGCTGCGGCAACAAGCTCGACTGCAAACCG
GATTGGGTGGGGCTACCGGCAGGAGTCAAGTTCGATCCGACGGACCAGGAGTTGATCGAG
CACCTCGAGGCCAAAGTGAGGGAAGAAGGCTCAAGATCTCATCCTCTCATCGATGAGTTC
ATACCCACGATAGAAGGGGAGGACGGCATATGCTACACCCACCCTGAGAAACTTCCAGGT
GAGAGTGAGAGAGCTAAGGTAGCTATAGCTCAAAACATTGCACCCCCCGCATTGTTTTGA
TACAGATATATTCCTGGCTTTTTGCAAAACTTTATCGGGTTTTTTTTGCTTTCCATGGAG
TGATATATATTGTATGCTGGGATTGTTTCGCCATGAATTATGGGTCGTGGTTTTGGATTT
TGGGATATGGCATATATTCCCTTGTTGTTCTTGATGTGCTCTCCCCCCTCTCTATTCTTA
TTACTAGTGTTTCTCTACATGTGCTCTTGGCCGGTATATGCAAAGAGAATTATTGTTTAT
GGAAAGTTGTGCCTAGTCTCATCTCCCACTCTCTCCTCTCTGTCATGATGGTAAGATGCT
TCTGAAGTTTCCAAATAGGTTTCTTTCCTCTCTTCCTCTTTTTCAGAGAGGTTTGTTGCA
TCTGTCAAGAAGCATAGGCCACCCACTCCACACTATACTCTTGGATCTCACAAAACTCTC
TATACTACCTTGATCCTGCTAATTATTCTGTTTGTGCTGATCGATCGATGGAGCAGGTGT
GACAAGGGACGGCCTGAGCAAGCACTTCTTCCACCGGCCGTCGAAGGCGTACACGACGGG
GACGAGGAAGCGGCGGAAGATCCAGACGGAGTGCGACGTGCAGAAGGGGGAGACGAGGTG
GCACAAGACCGGCAAGACCCGGCCGGTGATGGTGAGCGGCCGGCAGAAGGGGTGCAAGAA
GATACTGGTCCTCTACACCAACTTCGGCAAGCACCGCAAGCCGGAGAAGACCAACTGGGT
GATGCACCAGTACCACCTCGGCGACCTCGAGGAGGAGAAGGAAGGGGAGCTCGTCGTCTG
CAAGATCTTCTACCAGACGCAGCCTCGGCAGTGCAGCTGGTCCTCCGACCgcggcggcgg
cgccgccgccaccgcatccgccgtgacgacggcggcggtgcagcaggatcagcagcgcag
gagggacagcggcagcggcagctgctcgtcgacgagggaccacgaggtgtcggcgacgtc
ctactcgacggccgggtacgccgtcgccgccgccgtcgAGATGCAGCATTTGAAGCATGC
CGCCGACCATTTCAGCTTCGCGCCTTTCAGGAAGAGTTTCGAGGAGGTTGGTATAAGTGG
TGATCAGGTACACTCCAATCAGCTTGGGAGGTCGGAGCAGCAGCATGCTGGCCAGGAACA
ACAGCCGCACCGGCCGTTGCTTGCAACCACGACGGCGGTGCCTGCCACGGCCTTCCTGAT
CAGCCGGCCGACGAACCCTGTATCAAATATAGTGCCACCAGCAATGCAGCATGCATCTGT
CGTTCTTGATCATGATCAGTTCCACGTGCCAGCAATCCTTCTCCACCACGACAAATTTCA
GGTGTGATTTCATCTCATCTTATACATTTTCTCCTCAAATAAAACATTTCCATTATCTAA
AATAATTCCCTAAAATTAATACTAATTTCTCTTTTTCTAGCAGCTGGGTAATAGATTGGG
CACGGTAGCTGTTGAAAAAAAAACTATAGGAACACATATATGCATGCATTTATGAAGAAT
ATTCTTTACATATTCAGAATGTTAAATTTAAGTAAGGAGTAACAAACCATCTCCAACAAA
AAACAATTTCAGCTTGAAAACAAGCAATGGACTCGCTAGGCAGTACATTTCATACTTCCC
ATCTAGACAAACTTAATTAGTACGGCTTGGTCTAAAGTCCACATTTTCCTCCTTCAAGCT
AAGAGTTTCTTGCTATCATAGGATCCCTTTGAATTCTCTAAAAATAAACTAAAAACCATT
CTCAGCTTTCAATTTCAATAAAAAGAATCAAGGATTTGTGATAATCTTAAGTGTCAAAAT
TAGTCATTTTTAGTTGGTCATACTAAACATATTGGGCAATAATTTATACAAATAATTGTG
ATATACAAAATATTAAAAAAAATTCTAGTTATGGCACTTCTAATGTTGATTTGTACATAT
GTAGGGTTTTTCAAGTCGTGTAATTACTATTTGATATGAACTATGTTTTTTTATATATAT
ACCAAGGAAGTTGCATATGGATGAAATTAAGCTGTCTGAAGATGCATTTTCTAGACTATA
AATATAGAGCCTAGACAATTCTGGAAGGATTCTTTGTTTACCCATATATATATGTGTAAT
CTGGTAATGAATCTGCTTTGTATTTCCACCGTTCCTATATATATGTATCACTTTAGGTAA
ATCTATATACAATTGAACTGTTTATTTCATATATATCAAGATACTAATGCATTGTCTCAG
CTCATTCTTCATCTCTTTGGTGATTTACTTAATTATATTATTGTAGCTCCTTTACTTTTT
TTTTTCGTTTTGCTCTTTACTAAAGAATGCTTTAGCTACTGTTCTATCCCAACATAATTA
ACAACGAACATGCAACACAGCAGCAGCAGCAACAAAAGCTTGACAGGAGGTCTGCCGGCT
TGGAGGAACTGATAATGGGCTGCACGTCTTCGAGCACAAAAGGAGTAAGTTTCTCTTGCA
TTTTTATTTGATTGCCTCCTCAGCATGGATCCAAGCCGATAATTTACCAGTCAGAGGCTC
TACGCATGCAGTAAAGCATTCCTGCACATATCCAATTGGAATTAATATATATGCATGTAC
GTAGCAATTGCATGTGAGACGCATGCATGTGTCCCTTTTAAACGGTTTTAATCTGAACAT
TAGCTCAGGCCAAATTTAATATAATTGTAGTTATTTATATATACTGATTTAAACATATAA
TACATGGGTGGGAAAGCTGCAAGCTATGTCTTATAGGCGAGGTGAGGGGTTTAGAAAAGA
AAGACTGCTCAGGAGGGTCCTGAGGAAACTTCAGTGTGGGGCCTCATAGTTTCTTTGTCG
TCCTAGCCAGCACTTTGAAACAGGCCCTTCACCTTGACAGCTTTTTCCTCTCATTTGTTT
CCCTATTTTTAAATTCGCCATTTTAGGTGTGCTTTTACAGCAAGCATGCCGACGAGAGAG
AGAGAGAGAGAAATCTTCAGTACTCCTAGTGAGATAGTAGATAGAAGAAACATCATGAAT
ATATGCAAACAAGGACCACCCTTTGCTTTGCTTTTGAGTGCCAAAGGGGGAGAGCCAAAG
ACCAGCGTAAAAACAAGACCATACTTTCCTTGCTTTCATGACCGTATAGGTGAAAACGAG
AGCTTTCTCTCCATGTCAGTAGCCCCTCTCCTCGCTTTTCTGACTGTATGGCTATAAGAA
TAGTTGTTTACTGTTATCTCTTGCGAAAAGAGCAAAAGAAAAGGAGGAAATATTATTCGT
TTCTTGCTCTCTTTTGTCTCTTTTCTATGAAATGAATTCACACTGACACCATGCATGAGG
ATAAGAGAATCATTATTGTGAAATTTGTTTGCATTAATCGTTGTGAACTTGTTCTTGTAT
TACATTACTAAAAATTAAAATCTTGACATTTACAAGGTAGTATATACATGCACGTTCAGG
TAATATAGAACAAAAGTGTACTTATTTTTGTCAAAACTCCATTGGATGATTAGACATGAG
tagtacatccgtctcaaaatataataacttttagctacgaatttaaacaagagtatgtct
agattcgtagtcaataattgctatattttcgaacagatcaaggtagtaATGATATGTGTA
TTGCATAGTTATTCAATGAGATCGTTCTTTGACACGTTGGCCTCATTAATAATATGGTGC
AATGCGTTATATTGGAGATCAATCATTCTGACCCCGACTATATACTCCGTATAAGTAAGT
GACAAAAAGAGTTATGCCTTACTACTTTTCCCCTCCTTTGTTTTCGCGTTGAATTATATG
GGAGATTAATTAATAAAGTACTGTGACAACACAACTATAGTACTACTAGTCTACTACCGT
GGTATCTGCTATATCTCTCACAAGAGATCCGAATTGGCTACCTTGATATTATTTAAATGA
ACATTTCTGGTATCATCTGGAGTGTAAATAAGAGCAAGTACTATAAAACTTGCTCTAAGG
TAGTCCGTACTTGAACAGTTGAAAATTTTGAATTATTTCCCTACTGACATTTTAAAGTGA
TACCGTATCTTTCTTATTCAACTGTTGCACTTCACTGAGCTGTTCTTTTTTGACCCCCCC
TTTTCCATATTCTATTGCAGGAAGCTTCAATTCCTCACTCCCAAGAGACAGAATGGCCTT
ACCAGCCATACTGGACTCCTGACAACCAGGATCATCATGGATAGTAGCAACAAGGCTGGT
AAATAGTGAAGATCAATACCAAAAGAAAACTAACCACATTCTCTTTCACCTTGTGTGGTC
TCTGTCTTCTTGAATATACAACATTGCTTTCTTGAAGAATGTATGTACTACGGTTGGGAG
AAGAAATAGATTAAAGAGATCTGTATAGATCTGCCTCCATGAAAAAAGGGAGATCAAATT
AACTGTGCAAGGACACTCCAAGATAGAAGAGACAAAGTTGTTGAAAGAAAAGAAAAGAGA
GGACAAAAAAAGTTTGGGCAAAGGTATTGTTGTGCTTAATTACATCAGAATGAAGGCTAG
ACATGCTAGATGCAGTCAATATTAATGCACCCCAATCGAAGCATAATTATAATTACATTT
TGGTTTATCACAGCTTTTGATATGCATTAGATATTTTTCAACTGTAAAAAGTAGTATTGT
TTGCATGTACTGTGATGTACATTACACCCCCTGGCCGGTCCCTTCTCTCTCTAGATGGGT
GTGTGCGTGTGTGTTTTTCACCTTGCTTACCTTGTGCTTCAAATGCATCCAGGGGGACTA
AATTCCCAACTTAATAAGTTCTTTTTCCTTTCTAGAGGCGCAAAAATTGTTTAGCGTTTG
GGTACTGATGCTACTTACTTTGTAACGAGAGTTGAATTCATCTGCCATGCATGTTGGTTT
CAAGGAATAAACTGGCGTTGACATGCATGATTTTTGTGGTCTATATATATCACATATATA
TCAGATTACTCGATGATCTAACTAGTTAGTTTACTGCTGTACCTGTACATATGGATTTAA
GAATCAGAGTGGTGTTGGCTATATATTAAGAGTTATGCTTGCATACTGATACTGATGTAC
ATATACGTAAGCACAGAAAATTCCTTTGTTCATGTAAAAAAATATCAGCTCTCAATATAG
ACATGTGTTGTATTTAT

CDS

699 bp

>Os01t0191300-03 NAC transcription factor, Drought resistance
ATGGTGAGCGGCCGGCAGAAGGGGTGCAAGAAGATACTGGTCCTCTACACCAACTTCGGC
AAGCACCGCAAGCCGGAGAAGACCAACTGGGTGATGCACCAGTACCACCTCGGCGACCTC
GAGGAGGAGAAGGAAGGGGAGCTCGTCGTCTGCAAGATCTTCTACCAGACGCAGCCTCGG
CAGTGCAGCTGGTCCTCCGACCgcggcggcggcgccgccgccaccgcatccgccgtgacg
acggcggcggtgcagcaggatcagcagcgcaggagggacagcggcagcggcagctgctcg
tcgacgagggaccacgaggtgtcggcgacgtcctactcgacggccgggtacgccgtcgcc
gccgccgtcgAGATGCAGCATTTGAAGCATGCCGCCGACCATTTCAGCTTCGCGCCTTTC
AGGAAGAGTTTCGAGGAGGTTGGTATAAGTGGTGATCAGGTACACTCCAATCAGCTTGGG
AGGTCGGAGCAGCAGCATGCTGGCCAGGAACAACAGCCGCACCGGCCGTTGCTTGCAACC
ACGACGGCGGTGCCTGCCACGGCCTTCCTGATCAGCCGGCCGACGAACCCTGTATCAAAT
ATAGTGCCACCAGCAATGCAGCATGCATCTGTCGTTCTTGATCATGATCAGTTCCACGTG
CCAGCAATCCTTCTCCACCACGACAAATTTCAGGTGTGA

Protein

233 aa

>Os01t0191300-03 NAC transcription factor, Drought resistance
MVSGRQKGCKKILVLYTNFGKHRKPEKTNWVMHQYHLGDLEEEKEGELVVCKIFYQTQPR
QCSWSSDRGGGAAATASAVTTAAVQQDQQRRRDSGSGSCSSTRDHEVSATSYSTAGYAVA
AAVEMQHLKHAADHFSFAPFRKSFEEVGISGDQVHSNQLGRSEQQHAGQEQQPHRPLLAT
TTAVPATAFLISRPTNPVSNIVPPAMQHASVVLDHDQFHVPAILLHHDKFQV*

5'UTR

chr01:4885792..4885839 (- strand) : 48 bp

chr01:4885484..4885675 (- strand) : 192 bp

chr01:4884464..4885331 (- strand) : 868 bp

CDS

chr01:4884026..4884463 (- strand) : 438 bp

chr01:4883005..4883265 (- strand) : 261 bp

3'UTR

chr01:4879215..4883004 (- strand) : 3790 bp

FASTA

>Os01t0191300-03 class=Sequence position=chr01:4879215..4885839 (- strand)
TTTGCTCTTC TACTGCTCAT CCTCCTCCTC TACTACTCGT CCTCTTTGGT TTGCTTCCGG CCTCTTCTTC CTGCATAGCT
TCTGTTATTC GATTTCGATG ATCTTGTCTT CTCCTTGAAT TGTGTGTGTA TTAATTAACT GTATGTTTGT TTGATCCCTT
GCAGCTCTAT TCACAGCTAG CAACAAGAAG GAGGCTTACA CATGCATGTG CACGGTCTCT GCCGGACGCA TATGAATCAG
GCATGAATAG GGGGCACATC AGCAGCTCGG AGCTCATCGA CGCCAAGCTC GAGGAACGCC GGATCTCCAC GGCCAAGCAC
TGCCCCAGCT GCGGCAACAA GCTCGACTGC AAACCGGTAT GTGAAGAGTG AAGTGATCAA CTTCGTTTTG CCTAGCTCTT
TTCAGTAATT GCACACTTGC ACCTCGGTCG GTAGCGAGGG TTCTTGGGCT TCTTGCTGCC TGGTGCAAAA CTTGTTCTTA
TGGAATTAAT TGGTGTAACT GCAAGAAGGA TTGGGTGGGG CTACCGGCAG GAGTCAAGTT CGATCCGACG GACCAGGAGT
TGATCGAGCA CCTCGAGGCC AAAGTGAGGG AAGAAGGCTC AAGATCTCAT CCTCTCATCG ATGAGTTCAT ACCCACGATA
GAAGGGGAGG ACGGCATATG CTACACCCAC CCTGAGAAAC TTCCAGGTGA GAGTGAGAGA GCTAAGGTAG CTATAGCTCA
AAACATTGCA CCCCCCGCAT TGTTTTGATA CAGATATATT CCTGGCTTTT TGCAAAACTT TATCGGGTTT TTTTTGCTTT
CCATGGAGTG ATATATATTG TATGCTGGGA TTGTTTCGCC ATGAATTATG GGTCGTGGTT TTGGATTTTG GGATATGGCA
TATATTCCCT TGTTGTTCTT GATGTGCTCT CCCCCCTCTC TATTCTTATT ACTAGTGTTT CTCTACATGT GCTCTTGGCC
GGTATATGCA AAGAGAATTA TTGTTTATGG AAAGTTGTGC CTAGTCTCAT CTCCCACTCT CTCCTCTCTG TCATGATGGT
AAGATGCTTC TGAAGTTTCC AAATAGGTTT CTTTCCTCTC TTCCTCTTTT TCAGAGAGGT TTGTTGCATC TGTCAAGAAG
CATAGGCCAC CCACTCCACA CTATACTCTT GGATCTCACA AAACTCTCTA TACTACCTTG ATCCTGCTAA TTATTCTGTT
TGTGCTGATC GATCGATGGA GCAGGTGTGA CAAGGGACGG CCTGAGCAAG CACTTCTTCC ACCGGCCGTC GAAGGCGTAC
ACGACGGGGA CGAGGAAGCG GCGGAAGATC CAGACGGAGT GCGACGTGCA GAAGGGGGAG ACGAGGTGGC ACAAGACCGG
CAAGACCCGG CCGGTGATGG TGAGCGGCCG GCAGAAGGGG TGCAAGAAGA TACTGGTCCT CTACACCAAC TTCGGCAAGC
ACCGCAAGCC GGAGAAGACC AACTGGGTGA TGCACCAGTA CCACCTCGGC GACCTCGAGG AGGAGAAGGA AGGGGAGCTC
GTCGTCTGCA AGATCTTCTA CCAGACGCAG CCTCGGCAGT GCAGCTGGTC CTCCGACCgc ggcggcggcg ccgccgccac
cgcatccgcc gtgacgacgg cggcggtgca gcaggatcag cagcgcagga gggacagcgg cagcggcagc tgctcgtcga
cgagggacca cgaggtgtcg gcgacgtcct actcgacggc cgggtacgcc gtcgccgccg ccgtcgAGAT GCAGCATTTG
AAGCATGCCG CCGACCATTT CAGCTTCGCG CCTTTCAGGA AGAGTTTCGA GGAGGTAATT AATTTAATTA CCACTTGTTA
CATGCATACT GCCACTTTTC TGTATACATA CTGTATGAAT CTTTGATCAG TTTTCGGAGT AATGCTGGTT AGGTTACGCA
TCCTAATCAG TTTCTCTCCA AGTAAACTGC TGGTTAGGTT CTGTGCCGTT TTCTGCATGC ATCTTAATCA GTGCACGTCA
TGCAGATCAT GCAAATTAAC CATGGTCCAT ATTCCCATGC ACGCATGCAT GGATATATAT ACACTCGCTC GCATGGATAT
ATACTGACTT TCTGTTTTTC TAGGTGCAGA TTGGGATACA TATACTTTCT GTTTGATTAG ATGAGCTTCC TTCAATTTGT
TGCGTATGGA TGAGCGGTTT GGGGCGGGGT AGCTGACCAA ATGTGTAGGA TGCGCCAATT TAAAGCAAAA GATGAGCTAC
ACATCACACA GCAGCATGGA CCCTTTTAGT TCGAGCCTCA CATCATTTTA CTCAGATTGC AAGCAACCCT AAAACCATCC
ACGATCCACC CACCGTGAAA GCAAAAACTA GTAATATATA TAATTGGCCC GGTCTCATTC TTTCAATTAT TCCAACCAAA
AAATGTATAT TTCAAGAAAG TTCAAATAAT ATACATACTA CTGTAACATA CATACTAACT GAAAGGGAGT GATAAAAGAC
AAATATAATG GGAACATTAT GCATGTATGT TAGTTTTATA AAAAACATTA TGCATGCATG ACATGGAATT TTTCCATTTG
TTTGCATCAA ACAGGTTGGT ATAAGTGGTG ATCAGGTACA CTCCAATCAG CTTGGGAGGT CGGAGCAGCA GCATGCTGGC
CAGGAACAAC AGCCGCACCG GCCGTTGCTT GCAACCACGA CGGCGGTGCC TGCCACGGCC TTCCTGATCA GCCGGCCGAC
GAACCCTGTA TCAAATATAG TGCCACCAGC AATGCAGCAT GCATCTGTCG TTCTTGATCA TGATCAGTTC CACGTGCCAG
CAATCCTTCT CCACCACGAC AAATTTCAGG TGTGATTTCA TCTCATCTTA TACATTTTCT CCTCAAATAA AACATTTCCA
TTATCTAAAA TAATTCCCTA AAATTAATAC TAATTTCTCT TTTTCTAGCA GCTGGGTAAT AGATTGGGCA CGGTAGCTGT
TGAAAAAAAA ACTATAGGAA CACATATATG CATGCATTTA TGAAGAATAT TCTTTACATA TTCAGAATGT TAAATTTAAG
TAAGGAGTAA CAAACCATCT CCAACAAAAA ACAATTTCAG CTTGAAAACA AGCAATGGAC TCGCTAGGCA GTACATTTCA
TACTTCCCAT CTAGACAAAC TTAATTAGTA CGGCTTGGTC TAAAGTCCAC ATTTTCCTCC TTCAAGCTAA GAGTTTCTTG
CTATCATAGG ATCCCTTTGA ATTCTCTAAA AATAAACTAA AAACCATTCT CAGCTTTCAA TTTCAATAAA AAGAATCAAG
GATTTGTGAT AATCTTAAGT GTCAAAATTA GTCATTTTTA GTTGGTCATA CTAAACATAT TGGGCAATAA TTTATACAAA
TAATTGTGAT ATACAAAATA TTAAAAAAAA TTCTAGTTAT GGCACTTCTA ATGTTGATTT GTACATATGT AGGGTTTTTC
AAGTCGTGTA ATTACTATTT GATATGAACT ATGTTTTTTT ATATATATAC CAAGGAAGTT GCATATGGAT GAAATTAAGC
TGTCTGAAGA TGCATTTTCT AGACTATAAA TATAGAGCCT AGACAATTCT GGAAGGATTC TTTGTTTACC CATATATATA
TGTGTAATCT GGTAATGAAT CTGCTTTGTA TTTCCACCGT TCCTATATAT ATGTATCACT TTAGGTAAAT CTATATACAA
TTGAACTGTT TATTTCATAT ATATCAAGAT ACTAATGCAT TGTCTCAGCT CATTCTTCAT CTCTTTGGTG ATTTACTTAA
TTATATTATT GTAGCTCCTT TACTTTTTTT TTTCGTTTTG CTCTTTACTA AAGAATGCTT TAGCTACTGT TCTATCCCAA
CATAATTAAC AACGAACATG CAACACAGCA GCAGCAGCAA CAAAAGCTTG ACAGGAGGTC TGCCGGCTTG GAGGAACTGA
TAATGGGCTG CACGTCTTCG AGCACAAAAG GAGTAAGTTT CTCTTGCATT TTTATTTGAT TGCCTCCTCA GCATGGATCC
AAGCCGATAA TTTACCAGTC AGAGGCTCTA CGCATGCAGT AAAGCATTCC TGCACATATC CAATTGGAAT TAATATATAT
GCATGTACGT AGCAATTGCA TGTGAGACGC ATGCATGTGT CCCTTTTAAA CGGTTTTAAT CTGAACATTA GCTCAGGCCA
AATTTAATAT AATTGTAGTT ATTTATATAT ACTGATTTAA ACATATAATA CATGGGTGGG AAAGCTGCAA GCTATGTCTT
ATAGGCGAGG TGAGGGGTTT AGAAAAGAAA GACTGCTCAG GAGGGTCCTG AGGAAACTTC AGTGTGGGGC CTCATAGTTT
CTTTGTCGTC CTAGCCAGCA CTTTGAAACA GGCCCTTCAC CTTGACAGCT TTTTCCTCTC ATTTGTTTCC CTATTTTTAA
ATTCGCCATT TTAGGTGTGC TTTTACAGCA AGCATGCCGA CGAGAGAGAG AGAGAGAGAA ATCTTCAGTA CTCCTAGTGA
GATAGTAGAT AGAAGAAACA TCATGAATAT ATGCAAACAA GGACCACCCT TTGCTTTGCT TTTGAGTGCC AAAGGGGGAG
AGCCAAAGAC CAGCGTAAAA ACAAGACCAT ACTTTCCTTG CTTTCATGAC CGTATAGGTG AAAACGAGAG CTTTCTCTCC
ATGTCAGTAG CCCCTCTCCT CGCTTTTCTG ACTGTATGGC TATAAGAATA GTTGTTTACT GTTATCTCTT GCGAAAAGAG
CAAAAGAAAA GGAGGAAATA TTATTCGTTT CTTGCTCTCT TTTGTCTCTT TTCTATGAAA TGAATTCACA CTGACACCAT
GCATGAGGAT AAGAGAATCA TTATTGTGAA ATTTGTTTGC ATTAATCGTT GTGAACTTGT TCTTGTATTA CATTACTAAA
AATTAAAATC TTGACATTTA CAAGGTAGTA TATACATGCA CGTTCAGGTA ATATAGAACA AAAGTGTACT TATTTTTGTC
AAAACTCCAT TGGATGATTA GACATGAGta gtacatccgt ctcaaaatat aataactttt agctacgaat ttaaacaaga
gtatgtctag attcgtagtc aataattgct atattttcga acagatcaag gtagtaATGA TATGTGTATT GCATAGTTAT
TCAATGAGAT CGTTCTTTGA CACGTTGGCC TCATTAATAA TATGGTGCAA TGCGTTATAT TGGAGATCAA TCATTCTGAC
CCCGACTATA TACTCCGTAT AAGTAAGTGA CAAAAAGAGT TATGCCTTAC TACTTTTCCC CTCCTTTGTT TTCGCGTTGA
ATTATATGGG AGATTAATTA ATAAAGTACT GTGACAACAC AACTATAGTA CTACTAGTCT ACTACCGTGG TATCTGCTAT
ATCTCTCACA AGAGATCCGA ATTGGCTACC TTGATATTAT TTAAATGAAC ATTTCTGGTA TCATCTGGAG TGTAAATAAG
AGCAAGTACT ATAAAACTTG CTCTAAGGTA GTCCGTACTT GAACAGTTGA AAATTTTGAA TTATTTCCCT ACTGACATTT
TAAAGTGATA CCGTATCTTT CTTATTCAAC TGTTGCACTT CACTGAGCTG TTCTTTTTTG ACCCCCCCTT TTCCATATTC
TATTGCAGGA AGCTTCAATT CCTCACTCCC AAGAGACAGA ATGGCCTTAC CAGCCATACT GGACTCCTGA CAACCAGGAT
CATCATGGAT AGTAGCAACA AGGCTGGTAA ATAGTGAAGA TCAATACCAA AAGAAAACTA ACCACATTCT CTTTCACCTT
GTGTGGTCTC TGTCTTCTTG AATATACAAC ATTGCTTTCT TGAAGAATGT ATGTACTACG GTTGGGAGAA GAAATAGATT
AAAGAGATCT GTATAGATCT GCCTCCATGA AAAAAGGGAG ATCAAATTAA CTGTGCAAGG ACACTCCAAG ATAGAAGAGA
CAAAGTTGTT GAAAGAAAAG AAAAGAGAGG ACAAAAAAAG TTTGGGCAAA GGTATTGTTG TGCTTAATTA CATCAGAATG
AAGGCTAGAC ATGCTAGATG CAGTCAATAT TAATGCACCC CAATCGAAGC ATAATTATAA TTACATTTTG GTTTATCACA
GCTTTTGATA TGCATTAGAT ATTTTTCAAC TGTAAAAAGT AGTATTGTTT GCATGTACTG TGATGTACAT TACACCCCCT
GGCCGGTCCC TTCTCTCTCT AGATGGGTGT GTGCGTGTGT GTTTTTCACC TTGCTTACCT TGTGCTTCAA ATGCATCCAG
GGGGACTAAA TTCCCAACTT AATAAGTTCT TTTTCCTTTC TAGAGGCGCA AAAATTGTTT AGCGTTTGGG TACTGATGCT
ACTTACTTTG TAACGAGAGT TGAATTCATC TGCCATGCAT GTTGGTTTCA AGGAATAAAC TGGCGTTGAC ATGCATGATT
TTTGTGGTCT ATATATATCA CATATATATC AGATTACTCG ATGATCTAAC TAGTTAGTTT ACTGCTGTAC CTGTACATAT
GGATTTAAGA ATCAGAGTGG TGTTGGCTAT ATATTAAGAG TTATGCTTGC ATACTGATAC TGATGTACAT ATACGTAAGC
ACAGAAAATT CCTTTGTTCA TGTAAAAAAA TATCAGCTCT CAATATAGAC ATGTGTTGTA TTTAT

Locus: Os01g0191300

Loading...

Locus: Os01g0191300

Loading...