Os01t0194300-01

Locus

Os01g0194300

Description

Ankyrin-repeat protein, Herbivore-induced defense response, Blast disease resistance

RAP-DB Gene Symbol Synonym(s)

NH1, OsNH1, OsNPR1, OsNPR1/NH1, NPR1, OsPR2, PR2

RAP-DB Gene Name Synonym(s)

NPR1 HOMOLOG 1, NPR1-like 1, NPR1 homologue 1, nonexpresser of PR genes 1, Arabidopsis NPR1 homolog 1, non-expressor of pathogenesis-related gene 1, Arabidopsis NPR1 homologue 1, pathogenesis-related gene 2, nonexpressor of PR genes 1, Nonexpressor of Pathogenesis-Related Genes1, NONEXPRESSOR OF PATHOGENESIS-RELATED1 HOMOLOG1

CGSNL Gene Symbol

NH1

CGSNL Gene Name

NPR1 HOMOLOG 1

Oryzabase Gene Symbol Synonym(s)

OsNH1, OsNPR1, OsNPR1/NH1, NPR1, OsPR2, PR2

Oryzabase Gene Name Synonym(s)

NPR1-like 1, NPR1 homologue 1, nonexpresser of PR genes 1, Arabidopsis NPR1 homolog 1, non-expressor of pathogenesis-related gene 1, Arabidopsis NPR1 homologue 1, pathogenesis-related gene 2, nonexpressor of PR genes 1, Nonexpressor of Pathogenesis-Related Genes1, NONEXPRESSOR OF PATHOGENESIS-RELATED1 HOMOLOG1, NONEXPRESSOR OF PATHOGENESIS-RELATED GENES1, non-expressor pathogenesis-related 1

Transcript Evidence

DQ450947

AK120715

Protein Evidence

Q9FDY4

Literature

PMID: 22694163

PMID: 20924648

PMID: 17309686

Note

Manual Curation

May 23, 2016

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SKP1/BTB/POZ domain (IPR011333)

BTB/POZ domain (IPR000210)

Regulatory protein NPR, central domain (IPR024228)

Ankyrin repeat-containing domain (IPR020683)

NPR1/NIM1-like, C-terminal (IPR021094)

Ankyrin repeat (IPR002110)

Full-length cDNA

J023002C09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0194300-01)

RiceXPro (AK120715)

Others

Oryzabase (7370)

KEGG (Os01t0194300-01)

Transcript

2114 bp

>Os01t0194300-01 Ankyrin-repeat protein, Herbivore-induced defense response, Blast disease resistance
GAGGCCTCCTCCTCGCCTCGCCTCGCCACGCCGCGCCGCGACGCGACGCGCCGTGGTCAG
CTGGTCGCCGGTGCGGGTGCGGGTGCGCAATGGAGCCGCCGACCAGCCACGTCACCAACG
CGTTCTCCGACTCGGACAGCGCGTCCGTGGAGGAGGGGGGCGCCGACGCGGACGCCGACG
TGGAGGCGCTCCGCCGCCTCTCCGACAACCTCGCCGCGGCGTTCCGCTCGCCCGAGGACT
TCGCGTTCCTCGCCGACGCGCGCATCGCCGTCCCGGGCGGCGGCGGCGGCGGCGGCGACC
TGCTGGTGCACCGCTGCGTGCTCTCCGCGCGGAGCCCCTTCCTGCGCGGCGTCTTCGCGC
GCCGCGCCGCCGCCGCCGCAGGCGGCGGCGGCGAGGATGGCGGCGAGAGGCTGGAGCTCC
GGGAACTCCTCGGCGGCGGCGGCGAGGAGGTGGAGGTCGGGTACGAGGCGCTGCGGCTGG
TGCTCGACTACCTCTACAGCGGCCGCGTCGGCGACCTGCCCAAGGCGGCGTGCCTCTGCG
TCGACGAGGACTGCGCCCACGTCGGGTGCCACCCCGCCGTCGCGTTCATGGCGCAGGTCC
TCTTCGCCGCCTCCACCTTCCAGGTCGCCGAGCTCACCAACCTCTTCCAGCGGCGTCTCC
TTGATGTCCTTGATAAGGTTGAGGTAGATAACCTTCTATTGATCTTATCTGTTGCCAACT
TATGCAACAAATCTTGCATGAAACTGCTTGAAAGATGCCTTGATATGGTAGTCCGGTCAA
ACCTTGACATGATTACTCTTGAGAAGTCATTGCCTCCAGATGTTATCAAGCAGATTATTG
ATGCACGCCTAAGCCTCGGATTAATTTCACCAGAAAACAAGGGATTTCCTAACAAACATG
TGAGGAGGATACACAGAGCCCTTGACTCTGACGATGTAGAGCTAGTCAGGATGCTGCTCA
CTGAAGGACAGACAAATCTTGATGATGCGTTTGCACTGCACTACGCCGTCGAACATTGTG
ACTCCAAAATTACAACCGAGCTTTTGGATCTCGCACTTGCAGATGTTAATCATAGAAACC
CAAGAGGTTATACTGTTCTTCACATTGCTGCGAGGCGAAGAGAGCCTAAAATCATTGTCT
CCCTTTTAACCAAGGGGGCTCGGCCAGCAGATGTTACATTCGATGGGAGAAAAGCGGTTC
AAATCTCAAAAAGACTAACAAAACAAGGGGATTACTTTGGGGTTACCGAAGAAGGAAAAC
CTTCTCCAAAAGATAGGTTATGTATTGAAATACTGGAGCAAGCTGAAAGAAGGGACCCAC
AACTCGGAGAAGCATCAGTTTCTCTTGCAATGGCAGGTGAGAGTCTACGAGGAAGGTTGC
TGTATCTTGAAAACCGAGTTGCTTTGGCGAGGATTATGTTTCCGATGGAGGCAAGAGTAG
CAATGGATATTGCTCAAGTGGATGGAACTTTGGAATTTAACCTGGGTTCTGGTGCAAATC
CACCTCCTGAAAGACAACGGACAACTGTTGATCTAAATGAAAGTCCTTTCATAATGAAAG
AAGAACACTTAGCTCGGATGACGGCACTCTCCAAAACAGTGGAGCTCGGGAAACGCTTTT
TCCCGCGATGTTCGAACGTGCTCGACAAGATCATGGATGATGAAACTGATCCGGTTTCCC
TCGGAAGAGACACGTCCGCGGAGAAGAGGAAGAGGTTTCATGACCTGCAGGATGTTCTTC
AGAAGGCATTCCACGAGGACAAGGAGGAGAATGACAGGTCGGGGCTCTCGTCGTCGTCGT
CATCGACATCGATCGGGGCCATTCGACCAAGGAGATGAACACCATTGCTCCCAAATAGTT
GCCATATTGATAGCTAACTGTCCTCCTGGAGCTACTCACCTGATGGTTGCCTTCTGTCAA
TTGCCCCCCAAATATATTCTCAATGGTTTAGGCTTGTACAGTATTAGTTCTTACAGCTAT
TGCCCCGTCAATTGTGAAACGCAGAAGTTTCACTAGTGCTTGTACTCGAGGTGTAATACA
AGTGCTTGAATTTTGAGTTGTACTTGGAATTTCCAGTGGTTTGCTCGTAAAAATGAGATG
ATTTCTTGGCTCCC

CDS

1749 bp

>Os01t0194300-01 Ankyrin-repeat protein, Herbivore-induced defense response, Blast disease resistance
ATGGAGCCGCCGACCAGCCACGTCACCAACGCGTTCTCCGACTCGGACAGCGCGTCCGTG
GAGGAGGGGGGCGCCGACGCGGACGCCGACGTGGAGGCGCTCCGCCGCCTCTCCGACAAC
CTCGCCGCGGCGTTCCGCTCGCCCGAGGACTTCGCGTTCCTCGCCGACGCGCGCATCGCC
GTCCCGGGCGGCGGCGGCGGCGGCGGCGACCTGCTGGTGCACCGCTGCGTGCTCTCCGCG
CGGAGCCCCTTCCTGCGCGGCGTCTTCGCGCGCCGCGCCGCCGCCGCCGCAGGCGGCGGC
GGCGAGGATGGCGGCGAGAGGCTGGAGCTCCGGGAACTCCTCGGCGGCGGCGGCGAGGAG
GTGGAGGTCGGGTACGAGGCGCTGCGGCTGGTGCTCGACTACCTCTACAGCGGCCGCGTC
GGCGACCTGCCCAAGGCGGCGTGCCTCTGCGTCGACGAGGACTGCGCCCACGTCGGGTGC
CACCCCGCCGTCGCGTTCATGGCGCAGGTCCTCTTCGCCGCCTCCACCTTCCAGGTCGCC
GAGCTCACCAACCTCTTCCAGCGGCGTCTCCTTGATGTCCTTGATAAGGTTGAGGTAGAT
AACCTTCTATTGATCTTATCTGTTGCCAACTTATGCAACAAATCTTGCATGAAACTGCTT
GAAAGATGCCTTGATATGGTAGTCCGGTCAAACCTTGACATGATTACTCTTGAGAAGTCA
TTGCCTCCAGATGTTATCAAGCAGATTATTGATGCACGCCTAAGCCTCGGATTAATTTCA
CCAGAAAACAAGGGATTTCCTAACAAACATGTGAGGAGGATACACAGAGCCCTTGACTCT
GACGATGTAGAGCTAGTCAGGATGCTGCTCACTGAAGGACAGACAAATCTTGATGATGCG
TTTGCACTGCACTACGCCGTCGAACATTGTGACTCCAAAATTACAACCGAGCTTTTGGAT
CTCGCACTTGCAGATGTTAATCATAGAAACCCAAGAGGTTATACTGTTCTTCACATTGCT
GCGAGGCGAAGAGAGCCTAAAATCATTGTCTCCCTTTTAACCAAGGGGGCTCGGCCAGCA
GATGTTACATTCGATGGGAGAAAAGCGGTTCAAATCTCAAAAAGACTAACAAAACAAGGG
GATTACTTTGGGGTTACCGAAGAAGGAAAACCTTCTCCAAAAGATAGGTTATGTATTGAA
ATACTGGAGCAAGCTGAAAGAAGGGACCCACAACTCGGAGAAGCATCAGTTTCTCTTGCA
ATGGCAGGTGAGAGTCTACGAGGAAGGTTGCTGTATCTTGAAAACCGAGTTGCTTTGGCG
AGGATTATGTTTCCGATGGAGGCAAGAGTAGCAATGGATATTGCTCAAGTGGATGGAACT
TTGGAATTTAACCTGGGTTCTGGTGCAAATCCACCTCCTGAAAGACAACGGACAACTGTT
GATCTAAATGAAAGTCCTTTCATAATGAAAGAAGAACACTTAGCTCGGATGACGGCACTC
TCCAAAACAGTGGAGCTCGGGAAACGCTTTTTCCCGCGATGTTCGAACGTGCTCGACAAG
ATCATGGATGATGAAACTGATCCGGTTTCCCTCGGAAGAGACACGTCCGCGGAGAAGAGG
AAGAGGTTTCATGACCTGCAGGATGTTCTTCAGAAGGCATTCCACGAGGACAAGGAGGAG
AATGACAGGTCGGGGCTCTCGTCGTCGTCGTCATCGACATCGATCGGGGCCATTCGACCA
AGGAGATGA

Protein

583 aa

>Os01t0194300-01 Ankyrin-repeat protein, Herbivore-induced defense response, Blast disease resistance
MEPPTSHVTNAFSDSDSASVEEGGADADADVEALRRLSDNLAAAFRSPEDFAFLADARIA
VPGGGGGGGDLLVHRCVLSARSPFLRGVFARRAAAAAGGGGEDGGERLELRELLGGGGEE
VEVGYEALRLVLDYLYSGRVGDLPKAACLCVDEDCAHVGCHPAVAFMAQVLFAASTFQVA
ELTNLFQRRLLDVLDKVEVDNLLLILSVANLCNKSCMKLLERCLDMVVRSNLDMITLEKS
LPPDVIKQIIDARLSLGLISPENKGFPNKHVRRIHRALDSDDVELVRMLLTEGQTNLDDA
FALHYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAARRREPKIIVSLLTKGARPA
DVTFDGRKAVQISKRLTKQGDYFGVTEEGKPSPKDRLCIEILEQAERRDPQLGEASVSLA
MAGESLRGRLLYLENRVALARIMFPMEARVAMDIAQVDGTLEFNLGSGANPPPERQRTTV
DLNESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMDDETDPVSLGRDTSAEKR
KRFHDLQDVLQKAFHEDKEENDRSGLSSSSSSTSIGAIRPRR*

5'UTR

chr01:5065121..5065209 (- strand) : 89 bp

CDS

chr01:5064560..5065120 (- strand) : 561 bp

chr01:5062091..5062838 (- strand) : 748 bp

chr01:5061682..5061882 (- strand) : 201 bp

chr01:5060881..5061119 (- strand) : 239 bp

3'UTR

chr01:5060605..5060880 (- strand) : 276 bp

FASTA

>Os01t0194300-01 class=Sequence position=chr01:5060605..5065209 (- strand)
GAGGCCTCCT CCTCGCCTCG CCTCGCCACG CCGCGCCGCG ACGCGACGCG CCGTGGTCAG CTGGTCGCCG GTGCGGGTGC
GGGTGCGCAA TGGAGCCGCC GACCAGCCAC GTCACCAACG CGTTCTCCGA CTCGGACAGC GCGTCCGTGG AGGAGGGGGG
CGCCGACGCG GACGCCGACG TGGAGGCGCT CCGCCGCCTC TCCGACAACC TCGCCGCGGC GTTCCGCTCG CCCGAGGACT
TCGCGTTCCT CGCCGACGCG CGCATCGCCG TCCCGGGCGG CGGCGGCGGC GGCGGCGACC TGCTGGTGCA CCGCTGCGTG
CTCTCCGCGC GGAGCCCCTT CCTGCGCGGC GTCTTCGCGC GCCGCGCCGC CGCCGCCGCA GGCGGCGGCG GCGAGGATGG
CGGCGAGAGG CTGGAGCTCC GGGAACTCCT CGGCGGCGGC GGCGAGGAGG TGGAGGTCGG GTACGAGGCG CTGCGGCTGG
TGCTCGACTA CCTCTACAGC GGCCGCGTCG GCGACCTGCC CAAGGCGGCG TGCCTCTGCG TCGACGAGGA CTGCGCCCAC
GTCGGGTGCC ACCCCGCCGT CGCGTTCATG GCGCAGGTCC TCTTCGCCGC CTCCACCTTC CAGGTCGCCG AGCTCACCAA
CCTCTTCCAG GTCCGCCTCT TCGCAGCTGC CTCTCCTTTT CCCCTTCCAT TCGCGATGCT CATGTCATGC CAGTTCATCT
CTTCCCTGTG CTTGCTTGGA TGCGTATTGC TCATAGAAGT GGGGGTTTAA AGATGCATTT TTTTAGTTGC GCGCGTGGAG
CTTTGCTTTA GGCGGCAAAA TGAACTACTT CTGAAGGAGA GGGGAGATGG TCTGAACTGA ATCACTCCTA ATCACGTTAA
TCATTGCAAT TTGGATTACT GCAATTGGAG GCCTGTGATA ATTGCATTGT GATTAACTTG CTGTCATATT GGCGATGAAC
AGTATTCAGG TTTAGTTGTT TGCGATTTTG GGGATTCACG TGTGCTTGGT GCTGTATGCA TTGCAGAGAA AAACAAAAGC
TTACAGTTGT ATGAACGTGT GGATGCGACT CCCTGCTTCA ATTAGAAATC GTCCAAAAAG CTAGTACATC TTAAGCCATT
AATCAACTCA GATCATGCAC TGTTACATCG GTTATGTTTG ATCCAATCCT CCTAATCAGT TTATTCTAAT GTCTGAATCG
AACTGCCTGG CTAACTGTCC TTATCTAACA TGTTGCTGCT TACTGATCTT GGGGGTGCTT GCCGTTCTCG TTGTTATTTA
TCGGATTCTT CTTGGTCATG TTGACGCGAA AATGGAAGTT AACTGTGTTT GATATCCAGC AAGAGTGGTG CTGATATAGT
AAAGGTGTTT CTTAACCTTT TCTTTTCTTG CAAAAGAGCA GTTCCTTATT GAAGTATCTT CAGATAAGGC GATTGGACTG
TGCACCATCC TATTCTAGGC TGCTTCAAGT ACACATGTTT CACTCAATTG TACCATGATA GGGACATACT CACATACCGC
ACATTATCCT TCCAAATTTG TCAATGCTGC ATTAATGTGA CAGTGATATT TATGCACAGA AAGCACAATC ATATGTTTTC
CACTTAAACT TGACTGTATC TCAGTGTTTT TAAATTGAAA TGTCACACAT ATTCGAAGCA ATAATAAACG AACAACAAAA
AAAATATGCA TGTATCTTAT GGTAAAATTT GCCTTGGCTA TATTACAGGG GGAAAATGAG TGGCTACACT CCAATCACAG
CATGTTTATC CAAGAACACA AAAGGAAATT TCAAAATTTT AAATGTAAAA GCCTAAGGTC ACTAATGTTT ATATATATAT
CAACTTTTAT TCTCTTTACA GTCTTTGGAA GTTGTTTTTA GGAGTTATGG GGGTTGTTTT TCAGTAATTC TGTCTCAAAA
TTATATTGCT TGCGTGGCTG CGCCATACGT GCCAATCTGA CAAGAACCAA ACATGATTGT ACTAATTGTA TATATAGCCT
AGCTTCCTTT GGTCCAATTG ATGGCCCTCA GCCTTGTATT TATATTTATA AATCTTCTGG CGTTAACATT ACTCTACATT
GAACTTGCTA TTTCAAGTAT TATGTTGGTG TTTGGCTTGT AATATTTTGG TTTCTAAAAA GAATTAAAAC CAGGAAGTTT
CCTTTTCTAA TAAAAAATGG GCCTTGATGC TACTTGCTTT TGTTGACCTT TGTTTTAGAA CGTGGTACTG TTTTTTTCAG
ATAAGGCTGT TCCATACTGA ATCCATTAAT TATTGCTAGC CCAATGCATG TCAGTCGGTT ATCGTTTGTA ATGTTTCACT
ATTTTAAGAA GCCAGAACCA AAGCAATGAT ATATTCTTCT TTTTCATGCA GCGGCGTCTC CTTGATGTCC TTGATAAGGT
TGAGGTAGAT AACCTTCTAT TGATCTTATC TGTTGCCAAC TTATGCAACA AATCTTGCAT GAAACTGCTT GAAAGATGCC
TTGATATGGT AGTCCGGTCA AACCTTGACA TGATTACTCT TGAGAAGTCA TTGCCTCCAG ATGTTATCAA GCAGATTATT
GATGCACGCC TAAGCCTCGG ATTAATTTCA CCAGAAAACA AGGGATTTCC TAACAAACAT GTGAGGAGGA TACACAGAGC
CCTTGACTCT GACGATGTAG AGCTAGTCAG GATGCTGCTC ACTGAAGGAC AGACAAATCT TGATGATGCG TTTGCACTGC
ACTACGCCGT CGAACATTGT GACTCCAAAA TTACAACCGA GCTTTTGGAT CTCGCACTTG CAGATGTTAA TCATAGAAAC
CCAAGAGGTT ATACTGTTCT TCACATTGCT GCGAGGCGAA GAGAGCCTAA AATCATTGTC TCCCTTTTAA CCAAGGGGGC
TCGGCCAGCA GATGTTACAT TCGATGGGAG AAAAGCGGTT CAAATCTCAA AAAGACTAAC AAAACAAGGG GATTACTTTG
GGGTTACCGA AGAAGGAAAA CCTTCTCCAA AAGATAGGTT ATGTATTGAA ATACTGGAGC AAGCTGAAAG AAGGGACCCA
CAACTCGGAG AAGCATCAGT TTCTCTTGCA ATGGCAGGTG AGAGTCTACG AGGAAGGTTG CTGTATCTTG AAAACCGAGG
TAACCTTCAC ATATATCATA ATGGGTTCAT AATGCTGGTT TCTTTGGAAT TAACTGTTTT TGGTCTTGGC AACAAAAGGA
AGGTTACATT TCAGTTTAGT GTGTTTCATG CAGAGTGCAG TTTCAAGAGT TTCCCAGTGC CCATTTTTTA GAACTTCCAT
TTTGTTATGA AGTTGTATCT TGATATTATA GTTTTTGTAC GATGTAGTTG CTTTGGCGAG GATTATGTTT CCGATGGAGG
CAAGAGTAGC AATGGATATT GCTCAAGTGG ATGGAACTTT GGAATTTAAC CTGGGTTCTG GTGCAAATCC ACCTCCTGAA
AGACAACGGA CAACTGTTGA TCTAAATGAA AGTCCTTTCA TAATGAAAGA AGAACACTTA GCTCGGATGA CGGCACTCTC
CAAAACAGGT AATACACGGC ACTCTGTTTA TTCACACTGC CTCCAAGCGA TGTATATTTT GAATCTAATG CTACAAACTT
GTGTGGCACA CTGCTACACA TGCAAATATT TTTGATTTTT CATATTTTCT GATGGAAGCT AAAACTATAG ATGCTCCCAT
TTTGACTGAT AGGTTCACTG TTGAATACCC TGAGAGGTTT ATGCAATGTT GCATATCTTT TAGCTCTAAC ACTGTCAATG
TGAACCATGG ACAATTTTGC TCTTTTTTGT TCATTCAGAA TGATAGTTCA TACTACCTGA AGATTAAATA ATTGACAAAG
ATATGTACAC TTTACTGTGG TAATTTCTAA TTTTAATCTG GTCTTGAATA GGTAGCCTAG TTAATCTTTC TTGGGGTGCA
TGTGTTGTCT ATAGACTTTT GTGGTTGAAA AATCTTTGTA CATCAAGAGC ACAGAATATA CTTAGGTATA TCTATAGGAA
CAACTGCTTG AGATTCATCA CAGAAGTTGC AAAGACATTA CATTCTCTTA ATTGGACATA GACTAATTGC AAGCTGAATG
TGTATACCAG TGGAGCTCGG GAAACGCTTT TTCCCGCGAT GTTCGAACGT GCTCGACAAG ATCATGGATG ATGAAACTGA
TCCGGTTTCC CTCGGAAGAG ACACGTCCGC GGAGAAGAGG AAGAGGTTTC ATGACCTGCA GGATGTTCTT CAGAAGGCAT
TCCACGAGGA CAAGGAGGAG AATGACAGGT CGGGGCTCTC GTCGTCGTCG TCATCGACAT CGATCGGGGC CATTCGACCA
AGGAGATGAA CACCATTGCT CCCAAATAGT TGCCATATTG ATAGCTAACT GTCCTCCTGG AGCTACTCAC CTGATGGTTG
CCTTCTGTCA ATTGCCCCCC AAATATATTC TCAATGGTTT AGGCTTGTAC AGTATTAGTT CTTACAGCTA TTGCCCCGTC
AATTGTGAAA CGCAGAAGTT TCACTAGTGC TTGTACTCGA GGTGTAATAC AAGTGCTTGA ATTTTGAGTT GTACTTGGAA
TTTCCAGTGG TTTGCTCGTA AAAATGAGAT GATTTCTTGG CTCCC