Os01t0197100-01

Locus

Os01g0197100

Description

Cytochrome P450, Brassinosteroids biosynthesis, Regulation of plant architecture

RAP-DB Gene Symbol Synonym(s)

D2, D2a, CYP90D2/D2, d2, dwf2, CYP90D2, D2/CYP90D2, OsD2

RAP-DB Gene Name Synonym(s)

DWARF EBISU, ebisu dwarf, dwarf-2, cytochrome P450, CYP90D2, Ebisu dwarf/Dwarf2, Dwarf2

CGSNL Gene Symbol

D2

CGSNL Gene Name

DWARF EBISU

Oryzabase Gene Symbol Synonym(s)

d2, dwf2, CYP90D2, D2/CYP90D2, OsD2, SMG11, OsSMG11, D2/SMG11

Oryzabase Gene Name Synonym(s)

ebisu dwarf, dwarf-2, cytochrome P450 CYP90D2, Ebisu dwarf/Dwarf2, Dwarf2, SMALL GRAIN 11

Transcript Evidence

NM_001048832

Protein Evidence

Q94IW5

Literature

PMID: 14615594

PMID: 23902579

Note

Manual Curation

February 18, 2015

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Expression Databases

TENOR (Os01t0197100-00)

Others

Oryzabase (423)

Transcript

1485 bp

>Os01t0197100-01 Cytochrome P450, Brassinosteroids biosynthesis, Regulation of plant architecture
ATGGTGTCGGCGGCCGCCGGTTGGGCGGCGCCGGCGTTTGCGGTCGCCGCCGTGGTTATT
TGGGTGGTGCTGTGTAGTGAGCTCCTGCGGAGGCGGCGGCGTGGTGCAGGCAGCGGCAAG
GGGGACGCGGCGGCGGCGGCGCGCCTCCCGCCGGGGAGCTTCGGGTGGCCAGTGGTGGGC
GAGACGCTGGAGTTCGTGTCGTGCGCCTACTCGCCGCGCCCCGAGGCGTTCGTCGACAAG
CGCCGGAAGCTGCACGGGAGCGCGGTGTTCAGGTCGCACCTGTTCGGGTCGGCGACGGTG
GTGACGGCGGACGCGGAGGTGAGCCGGTTCGTGCTGCAGAGCGACGCGCGGGCGTTCGTG
CCGTGGTACCCGCGGTCGCTGACGGAGCTGATGGGCAAGTCCTCCATCCTCCTCATCAAC
GGCGCGCTCCAGCGACGCGTCCACGGCCTCGTCGGCGCCTTCTTCAAGTCCTCCCACCTC
AAGTCCCAGCTCACCGCCGACATGCGCCGCCGCCTCTCCCCCGCCCTCTCCTCCTTCCCC
GACTCCTCCCTCCTCCACGTCCAGCACCTCGCCAAGTCGGTGGTGTTCGAAATCCTGGTG
AGGGGCCTGATCGGGCTGGAGGCAGGGGAGGAGATGCAGCAGCTGAAGCAGCAATTCCAG
GAATTTATTGTCGGCCTCATGTCCCTCCCCATTAAGCTGCCTGGCACTAGGCTCTACAGA
TCACTCCAGGCCAAGAAGAAgatggcgaggctgatacagaggatcatccgggagaagagg
gcaaggagggccgccgcctcgccgccgcgggacgccatcgacgtgctcatcggagacggc
agcgatgagctcaccgacgagctcatctccgacaacatgatcgacctcatgatccccgcc
gaggactccgtcccggtgctcatcacgctcgccgtcaagttcctcagcgagtgccctctc
gccctgcaccaactggaaGAGGAGAACATACAGCTCAAGAGGCGAAAAACCGACATGGGT
GAGACCTTGCAATGGACAGACTACATGTCATTGTCATTCACACAACATGTGATAACAGAG
ACGCTGCGGTTGGGCAACATCATCGGTGGGATCATGCGCAAGGCGGTGCGCGACGTCGAG
GTGAAGGGGCACCTCATCCCCAAGGGGTGGTGCGTGTTTGTGTACTTCCGGTCAGTCCAC
CTCGATGATACGCTCTACGATGAGCCCTACAAGTTCAACCCATGGAGGTGGAAGGAGAAG
GACATGAGCAATGGCAGCTTCACTCCTTTTGGTGGTGGGCAGAGGCTGTGCCCAGGCCTG
GATCTGGCCAGGCTGGAAGCTTCCATCTTCCTTCACCACTTGGTCACCAGCTTCAGGTGG
GTGGCGGAGGAGGACCACATCGTCAACTTCCCCACCGTGCGGCTCAAGCGGGGCATGCCC
ATCAGGGTCACCGCCAAGGAGGACGACGACTAGCCACTAGCCACC

CDS

1473 bp

>Os01t0197100-01 Cytochrome P450, Brassinosteroids biosynthesis, Regulation of plant architecture
ATGGTGTCGGCGGCCGCCGGTTGGGCGGCGCCGGCGTTTGCGGTCGCCGCCGTGGTTATT
TGGGTGGTGCTGTGTAGTGAGCTCCTGCGGAGGCGGCGGCGTGGTGCAGGCAGCGGCAAG
GGGGACGCGGCGGCGGCGGCGCGCCTCCCGCCGGGGAGCTTCGGGTGGCCAGTGGTGGGC
GAGACGCTGGAGTTCGTGTCGTGCGCCTACTCGCCGCGCCCCGAGGCGTTCGTCGACAAG
CGCCGGAAGCTGCACGGGAGCGCGGTGTTCAGGTCGCACCTGTTCGGGTCGGCGACGGTG
GTGACGGCGGACGCGGAGGTGAGCCGGTTCGTGCTGCAGAGCGACGCGCGGGCGTTCGTG
CCGTGGTACCCGCGGTCGCTGACGGAGCTGATGGGCAAGTCCTCCATCCTCCTCATCAAC
GGCGCGCTCCAGCGACGCGTCCACGGCCTCGTCGGCGCCTTCTTCAAGTCCTCCCACCTC
AAGTCCCAGCTCACCGCCGACATGCGCCGCCGCCTCTCCCCCGCCCTCTCCTCCTTCCCC
GACTCCTCCCTCCTCCACGTCCAGCACCTCGCCAAGTCGGTGGTGTTCGAAATCCTGGTG
AGGGGCCTGATCGGGCTGGAGGCAGGGGAGGAGATGCAGCAGCTGAAGCAGCAATTCCAG
GAATTTATTGTCGGCCTCATGTCCCTCCCCATTAAGCTGCCTGGCACTAGGCTCTACAGA
TCACTCCAGGCCAAGAAGAAgatggcgaggctgatacagaggatcatccgggagaagagg
gcaaggagggccgccgcctcgccgccgcgggacgccatcgacgtgctcatcggagacggc
agcgatgagctcaccgacgagctcatctccgacaacatgatcgacctcatgatccccgcc
gaggactccgtcccggtgctcatcacgctcgccgtcaagttcctcagcgagtgccctctc
gccctgcaccaactggaaGAGGAGAACATACAGCTCAAGAGGCGAAAAACCGACATGGGT
GAGACCTTGCAATGGACAGACTACATGTCATTGTCATTCACACAACATGTGATAACAGAG
ACGCTGCGGTTGGGCAACATCATCGGTGGGATCATGCGCAAGGCGGTGCGCGACGTCGAG
GTGAAGGGGCACCTCATCCCCAAGGGGTGGTGCGTGTTTGTGTACTTCCGGTCAGTCCAC
CTCGATGATACGCTCTACGATGAGCCCTACAAGTTCAACCCATGGAGGTGGAAGGAGAAG
GACATGAGCAATGGCAGCTTCACTCCTTTTGGTGGTGGGCAGAGGCTGTGCCCAGGCCTG
GATCTGGCCAGGCTGGAAGCTTCCATCTTCCTTCACCACTTGGTCACCAGCTTCAGGTGG
GTGGCGGAGGAGGACCACATCGTCAACTTCCCCACCGTGCGGCTCAAGCGGGGCATGCCC
ATCAGGGTCACCGCCAAGGAGGACGACGACTAG

Protein

491 aa

>Os01t0197100-01 Cytochrome P450, Brassinosteroids biosynthesis, Regulation of plant architecture
MVSAAAGWAAPAFAVAAVVIWVVLCSELLRRRRRGAGSGKGDAAAAARLPPGSFGWPVVG
ETLEFVSCAYSPRPEAFVDKRRKLHGSAVFRSHLFGSATVVTADAEVSRFVLQSDARAFV
PWYPRSLTELMGKSSILLINGALQRRVHGLVGAFFKSSHLKSQLTADMRRRLSPALSSFP
DSSLLHVQHLAKSVVFEILVRGLIGLEAGEEMQQLKQQFQEFIVGLMSLPIKLPGTRLYR
SLQAKKKMARLIQRIIREKRARRAAASPPRDAIDVLIGDGSDELTDELISDNMIDLMIPA
EDSVPVLITLAVKFLSECPLALHQLEEENIQLKRRKTDMGETLQWTDYMSLSFTQHVITE
TLRLGNIIGGIMRKAVRDVEVKGHLIPKGWCVFVYFRSVHLDDTLYDEPYKFNPWRWKEK
DMSNGSFTPFGGGQRLCPGLDLARLEASIFLHHLVTSFRWVAEEDHIVNFPTVRLKRGMP
IRVTAKEDDD*

CDS

chr01:5236623..5236873 (+ strand) : 251 bp

chr01:5236958..5237285 (+ strand) : 328 bp

chr01:5237786..5237935 (+ strand) : 150 bp

chr01:5238255..5238503 (+ strand) : 249 bp

chr01:5239581..5239670 (+ strand) : 90 bp

chr01:5239781..5239966 (+ strand) : 186 bp

chr01:5240477..5240598 (+ strand) : 122 bp

chr01:5243915..5244011 (+ strand) : 97 bp

3'UTR

chr01:5244012..5244023 (+ strand) : 12 bp

FASTA

>Os01t0197100-01 class=Sequence position=chr01:5236623..5244023 (+ strand)
ATGGTGTCGG CGGCCGCCGG TTGGGCGGCG CCGGCGTTTG CGGTCGCCGC CGTGGTTATT TGGGTGGTGC TGTGTAGTGA
GCTCCTGCGG AGGCGGCGGC GTGGTGCAGG CAGCGGCAAG GGGGACGCGG CGGCGGCGGC GCGCCTCCCG CCGGGGAGCT
TCGGGTGGCC AGTGGTGGGC GAGACGCTGG AGTTCGTGTC GTGCGCCTAC TCGCCGCGCC CCGAGGCGTT CGTCGACAAG
CGCCGGAAGC TGTAAGCCTA GCCACCTCCG CCGCCGCCGC CGTCCCGAGG CGTTCGGCTC TGACTGACGG GCATGGGTGT
GCATGCATGG TGCAGGCACG GGAGCGCGGT GTTCAGGTCG CACCTGTTCG GGTCGGCGAC GGTGGTGACG GCGGACGCGG
AGGTGAGCCG GTTCGTGCTG CAGAGCGACG CGCGGGCGTT CGTGCCGTGG TACCCGCGGT CGCTGACGGA GCTGATGGGC
AAGTCCTCCA TCCTCCTCAT CAACGGCGCG CTCCAGCGAC GCGTCCACGG CCTCGTCGGC GCCTTCTTCA AGTCCTCCCA
CCTCAAGTCC CAGCTCACCG CCGACATGCG CCGCCGCCTC TCCCCCGCCC TCTCCTCCTT CCCCGACTCC TCCCTCCTCC
ACGTCCAGCA CCTCGCCAAG TCGGTACGTC CTCCTTCTTC TCCCTCTCCG GCGAGCTCCT CGACGAGATA GAGTGGGTGG
ATGAATTGGA GGAGGAGCAG AGTGGGTGGG CGTGGGCGAG CGCCGGCGTG CGTGCACACG TGCGCGCCCG TGTCACCACA
TGGAAGTAAC TTACACAAGG CCGGGAAAGG GAAGGCCCAA AAGGAGTGGG CCCAATCACA CACACTCTCT CTCTCTCTCT
CTCTCTCTCT CTCTCATCTC ATATTCTGAC TCTAGAGAGA GAGAGAGTGG CTCACCTCCA TGTGGGCCCC ACCCCATCGG
AGTAGAGTTA CCACTACCAG CAGCCGAAAA TCCACGTTCC TGTTCGCCAC CAGAGCGTGT GTTTGTGCAC TCGTAAATGT
TTATTTTTTC TCTGCGTATT CCTCTGGAAG AGATGCAAAT ACAGTCTTGA ACATTTGTAA TTTTTAGAGA TGAGGATGGA
ACGAAATGTA ATTGCAAGAA ATGGTGATGA AATGCAAATG CAGGTGGTGT TCGAAATCCT GGTGAGGGGC CTGATCGGGC
TGGAGGCAGG GGAGGAGATG CAGCAGCTGA AGCAGCAATT CCAGGAATTT ATTGTCGGCC TCATGTCCCT CCCCATTAAG
CTGCCTGGCA CTAGGCTCTA CAGATCACTC CAGGTACTCT CTCTCTCTCT CTCTCCCTCT CATCTAAGTT CTCTTTCTCT
CTCTACCTGT AGTACTCCAT GTAAACCTGC ACTGCACCAC ACATTGATCT CTACTACTCT CTTCTGTCAG CCACTCTGTC
TCTCCTTTAT GTCTGATGTT GCTCAGCCCT ACTCCATGCA GCATCAGCAG CAGCATGATC AGTGTCTCAG CTGCCATCAC
CATTAACCTC TCTTAATATG TTCTCTCTGT TTCACAATCT TGGATTAAAT GTATACAATT GCACTCGATC CATTGCACAT
TTTTGACACA TTATTGTGTG TGTGGTCATC AGGCCAAGAA GAAgatggcg aggctgatac agaggatcat ccgggagaag
agggcaagga gggccgccgc ctcgccgccg cgggacgcca tcgacgtgct catcggagac ggcagcgatg agctcaccga
cgagctcatc tccgacaaca tgatcgacct catgatcccc gccgaggact ccgtcccggt gctcatcacg ctcgccgtca
agttcctcag cgagtgccct ctcgccctgc accaactgga agtaagcctG TATACCTGAA ACCTCTCTTA CAACACAGTA
AGCTCTTAAT TGGATCAATA CCTGCATATA ATTAGATGCT AGAGATGAAT CCTGAACAGA AAAGAAAAAT AAAACCATAC
CCTAGGAAGT AATTAAGGAT CCTCTGTTGC TGGGCATGGG CAGTCAGCAA AAAGGGTCCA GAACTGAAAA GAGTTGGATT
TTCTTTCTTT TTTGTCTGAA AGGAACATGA TCAACTATTC ATTTTGTCAG AGCCATGTGT TGTGCATGAT ATACTACTAT
CACTATTGTC TACTACACAC AATGGCAGAG GATCTGTGTC CCCAAACAAA AACTAGATCA TAAAAAGCCT ACGAATAAGG
GAGAGATACG TAGGTGGGCA GAAGGGATCA GCAGCATATA AAGGGTTGTG CCAACCTTGG TCCATCCCTT TCTTGTTGGC
ATCTTAGAGC TATCATTATT ATTTGTTATC TAATGTGCCA TCTGAAAAGA AATACTACTA CTACTTGTGT TTGGACCAAT
CTTTGCAAGA TGACGTGCGT TGCATCATTG TCAATGTCAG GTCGGGTACA TACATATCAT TAGAACAGAG TCGCCTTCTC
ACAAAAGAAA AGGCTTACTA TCATGATGTA TCATCTACTT ACATATCATT AGTTTGTGCT ATTATGCGTT TTTTTTTTCT
AACCGGCTAT AAACGCATGT GCAAGGAATA GTTTTTTTGG TTGAAGTATG GAGGGTTTTT TATCAACTGG GGAAAAAAGA
AGGTTACATA ATTTGGCTAT TTATTCTATG GAGATTAGAA GGCAGCAGTA ATATTTCCTA GCTAGCATGT CCTATTACAC
CAGTAGCATT GTGTCATATG CTAGATTCCA TTTACATCAC TACAGTGCTA AGAAATTACT CGCGTGTCGA CTGTGTTTCT
GTTTTGATGC CATGTGAGCA ATAAACTCAT TGAAACCTCT GCATGTCTAC CACTGTTAGA GAACATGCAT ATCGCGGCTG
AAGATAAAAT CCACCGTCAG TAATTACTTG TTGTAACAAT GATGAATAAT AACACCAATC ACATTCTAAT GCTACCAGGA
GGAGAACATA CAGCTCAAGA GGCGAAAAAC CGACATGGGT GAGACCTTGC AATGGACAGA CTACATGTCA TTGTCATTCA
CACAACATGT AAGTATAGTT CATTAACACT GTAACATAAA TTTCTATAGC TCAAAATCTA CTGGCCCCGT GTGGTTTTTT
TCCCATGACC CCATGCGATT TGGAAAATTG GAGTGTAGGT GATAACAGAG ACGCTGCGGT TGGGCAACAT CATCGGTGGG
ATCATGCGCA AGGCGGTGCG CGACGTCGAG GTGAAGGGGC ACCTCATCCC CAAGGGGTGG TGCGTGTTTG TGTACTTCCG
GTCAGTCCAC CTCGATGATA CGCTCTACGA TGAGCCCTAC AAGTTCAACC CATGGAGGTG GAAGGTAAGA AAGAGCCCCA
CATTTGGTAG AGATGTTCAT CCAATTGCTA CCCCTTTAGG CAACACCAGC ATAATAAGGA TTTGATGAGT GCGGTTTTGG
TGGGACTCCT AACATGTGGG CTTACTTCTA TATCAGTAAT CTCATGATGG ATTTGACATT GCCTTGTACT AACACTTAGT
ATTGCAGAAA ATAACAGAGA TTCCCTCAAA GTTGCATTAG TGATTGATAT ATACACCTAG GCAGAAGTCA ATTGAATCTC
CCAAAATAAC TGGATTTGGT AGTTCTTTGA ACTGGTAAAT TCAGACAACA TAAGCTTAAG CTGTCCAGGA AAGGAATACA
CACCCTTTTT TTCCCTCTAT TGTGTACTTT GTGTAAGCTC TGAAAATGAT ATGCAAATAA TTAATCTAGG CAAATGATGG
TGCTGTACTA CTGTTGAGGC ATCCTATCAT TATGATTTGA TTTGGGAAGT CTAATAATGT GCTAATTGGT CAAGAAATCA
ATCAATCTCA ACAGGAGAAG GACATGAGCA ATGGCAGCTT CACTCCTTTT GGTGGTGGGC AGAGGCTGTG CCCAGGCCTG
GATCTGGCCA GGCTGGAAGC TTCCATCTTC CTTCACCACT TGGTCACCAG CTTCAGGTAT GGATCACCAC ATCTCAATCT
TGGCCATTCT TAGTGCAGCC ATTGATTCCA ACTCCTTAGC TTTGTTTCAT GATCACTTGG CAACAATAGC TTTTTTTTCT
TTCTAGATAA TGGAATACAA ACTACAACTT TTGCATAATT TTCCATGATC GCTCGGCACC GATAGCATTT TTTTCTAGAT
AAAAGAATAA AAATCACGAC CTCTACATCA TATAATGAAT GGAATAAAAA TCACGGCCTT TGCATCATAT AATGCACGCA
ACCGGGCACC AATGGCATGC ATCTCATGTA GTCATGTCCC TATCATTTGG CCATGCCCTC TTCGCATGCA CATTCATGTT
CCTAGTAATA ACTAATCTCT GTAGAACAAT AGAAGAGCGG AACAGTAGAT GAATTATGCG TTGATTGACA GAATAATTGT
GGGGGGGTAT ATAGATCGGG TACGTACATG AGGATTTGAA GATCAAGCCG AATCTTTCCA GAGATAAAAA AAAAAGAAAA
AAATTATGTC AGATAATAAC TGGTCCTAAT ACGTCACTAG GGATAGCATC ACGAGGCTTT CTCCCATGCT TATACCTCCT
CTGTTATCAT CTTCCTTGAG GGAGTGATCT TACTGTGCTT AAGGAGGTAT CTAAAGCGGT GGTGAAGCCA GCGACATCGT
CGAGCCCGGA TAACTAATAG TGTTTTGTAG TGATCAATCC ATTTTTACAC GCGTCAACGG TGATTGGTAG TGGAGACGCC
GACAGCGAAG CCTAGACGGT CGTTCGACCT GGAGCCGTCT CCACCTCTGA TCGAAAGATA TAGTATGGTA TTTTCGCCTC
TCACACTGGG AGATACAACT TTCGGCCTAC AAAATCAACT TCTGGTTTTA AATCTAAGAT ATAGATTATT TCTAGATTCA
AGCTTAGAAA TTGTTTTTTT TAAGAGACAG AGATAGTACC AAATTCTATT TCTATAATTT TCTTAAATAC AGTAAATTAT
TTCTTCTCGC GAGGAGGATT ACACTGCGTA GGAACACTAG GTCATTTTTC ATGTGAAAGA AAAAAATGGA AGCTACGAGG
AAGACAAATA ATTTCGGCGC GCGGGGCGAA AAAGAAGAAG ATCAAGGAAG ATACCCAAGG TGGGAGGTCG GTCCAGCCTC
TATTGCGAAT AGAGCGGGGT GTTGTTCCGC GCGTGGGGCC ACACGTGCGC GCACATGCGG CGCATATCCA TCCCTTCCCC
CCCACACCCA CATGTGTGCA TGCATGCGGA CTACGCCGCT GTACGCGTGC GTGGCTTACG GCGCCCGCTG CTACAGCTAC
AGCGCCCGCA CGTGTCAGCT ACCACGCCAC GCCCTGCATG CCCACCGCCG CTGCACCTCC CCTTGAGACG TGGTCGCTGG
GCGGTGGTGG GTCTCACATG TCAGTACGTC TTTCGTCAAA AAAAAAATTC AACTTTAATT TGTTTTTTTC ATGGTCTCAC
AACCATGTAG CTTACCAATG CAAACAGACT AATCTAAAAA AAAAAAAATA AGCTTAGCTA TAATGCACGC TTCGATTAAG
CAATGTTACG ATGCGTGTGC TTAGCTCAGG ATAGTGCCTA TATTGACACG AAAATATACT ACATCCATAT AAAAAAATAT
AAGCATTTTT TACTATAAAT TTATATATTT ATTCATATTT ATAGCTAAAA ATACTTATAT TTTGGGTCGG AGCGAGTATC
ATATTTTGAT TACCAGTCGT CCATCAGCTA TGGAGTCTGT ATAGGGCTAC GTCCTACGTT CGGGAGGTAG AAAATATGGT
GATTTATTTT ATTTTTTTGC GGGGaaatat ggtgatttat taatatatga ttaattaagt attagttaaa aacttaaaga
ataggttaat ataaatttaa aaataatttt tatataaaaa atcgtattgt ttagtagttt agaaaatgtg cCGGATCGGG
TTGAGTTGGG AAAGGAGGCG GGAAGAAGCG TGGTGTAGTA ATTGGCGAAG GGGGTAAGAA GGGGGAGACC GGAGACATGG
GTGTGATGGT TAGGCAGCCG GAATGGGCTC TCTATCGACT CGAACAGTTG GATGAGATGA GACGAGATGG GTGACATGCG
TGCGTGCATG CATACTTTGT GCCTTGTCCG GTCCGTGACT GAACTGAATC CCAGGAACGC GAATATAATA CTGTAGCACG
CACGCACGCA CGCACGCATC CAGCTGATCT AGCCGGCCGA GATGTGCCAC TTTGACCGGT CGTCAGACAC GCTGCATCAA
TGTAGGAGCA CGTGCCAGGG TATGGTCGCT GCATGCCTGC CTGCAAACAA TACTATACTC CTCCCATAAA CAAATCAAAC
TCCAACAAGA GAATCCGACT TGCTAGAAAA ACATCATATC ACTTTAAACA ATGGAGATTG GAGAGTCCAT CAGTCCAATG
TGTTTTTCTG TCTTCTTTGA CCATCTTCCA ATTCCCCATT ATGCTTGTGC TGACCTCTAT CTAATTGATC CTAAGAGAAG
CGTTTTGCAA CATCTTGTAA AAAAGCAAAT CACATAATAT TACTCGTGCT TTATGTAGCT AAGCTACATT GGATCAGGAT
CCTCTGCAGT CAAAGTCACG TGACTTTGTC ACTGACATTG TGGGTCCGAT AATCATTGGG TCCACATGTC TTACAAAGAC
AATCCGGCTA CATCATCATG CCAGTTTCCG TAATAAATTG ACCAGTAATT TAGTACTATG GACTTTAGAA CCTGGCACAT
GCATAGCACA GATTCATGCA TGCGTGCACT GCATCTGCAC GCATTTGCAT TGGTTGCACA AGCAGCTAGC TGGCCTACAT
ATAACATATT ACTGTGTTAT GCGAGCAACT GGCCACTGTC CACATGAAGC CAGTAAATCA ACTATCAACA TTGATAGTAG
TAAAGCTCTT GTTCAGAGTT GCAGGCATAT AGGTGCTCCC TGCATGGTTT GCTCAAACTT AAGATAGATG ATACTACATT
CTAAAAATGC AAGTATTTCT GGTATGTATC TGGACAAGAT GGTTAGGACT CTAGCTATAA CATAGAAAAT GCTTATATTA
GAATACACTT CATTCGTCTC AAAATATAAG GTATTTTGAT CGGATATCGA TCCCATCCGG TTAAATACCT TAAGTAGGGA
GTGGCAGTGG CATCACCATC GATCATGTGT TATTGATAAA TGATTATGAT TATGAGATCT CTTATCTACA ATCTCTTTCT
GAATAATCGA CCTGCTGATC CATCCATTGC ATGCATGGTT GTTGCCTGAC AAGGACATTG AAATGGACTG CTAATTGCTG
CCATGGATGC AGGTGGGTGG CGGAGGAGGA CCACATCGTC AACTTCCCCA CCGTGCGGCT CAAGCGGGGC ATGCCCATCA
GGGTCACCGC CAAGGAGGAC GACGACTAGC CACTAGCCAC C