Os01t0197100-02

Locus

Os01g0197100

Description

Cytochrome P450 (Splicing variant)

RAP-DB Gene Symbol Synonym(s)

D2, D2b, CYP90D2/D2, d2, dwf2, CYP90D2, D2/CYP90D2, OsD2

RAP-DB Gene Name Synonym(s)

DWARF EBISU, ebisu dwarf, dwarf-2, cytochrome P450, CYP90D2, Ebisu dwarf/Dwarf2, Dwarf2

CGSNL Gene Symbol

D2

CGSNL Gene Name

DWARF EBISU

Oryzabase Gene Symbol Synonym(s)

d2, dwf2, CYP90D2, D2/CYP90D2, OsD2, SMG11, OsSMG11, D2/SMG11

Oryzabase Gene Name Synonym(s)

ebisu dwarf, dwarf-2, cytochrome P450 CYP90D2, Ebisu dwarf/Dwarf2, Dwarf2, SMALL GRAIN 11

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 23902579

Note

Manual Curation

February 19, 2015

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Others

Oryzabase (423)

Transcript

1346 bp

>Os01t0197100-02 Cytochrome P450 (Splicing variant)
GTTCTCTCTGTTTCACAATCTTGGATTAAATGTATACAATTGCACTCGATCCATTGCACA
TTTTTGACACATTATTGTGTGTGTGGTCATCAGGCCAAGAAGAAgatggcgaggctgata
cagaggatcatccgggagaagagggcaaggagggccgccgcctcgccgccgcgggacgcc
atcgacgtgctcatcggagacggcagcgatgagctcaccgacgagctcatctccgacaac
atgatcgacctcatgatccccgccgaggactccgtcccggtgctcatcacgctcgccgtc
aagttcctcagcgagtgccctctcgccctgcaccaactggaaGAGGAGAACATACAGCTC
AAGAGGCGAAAAACCGACATGGGTGAGACCTTGCAATGGACAGACTACATGTCATTGTCA
TTCACACAACATGTGATAACAGAGACGCTGCGGTTGGGCAACATCATCGGTGGGATCATG
CGCAAGGCGGTGCGCGACGTCGAGGTGAAGGGGCACCTCATCCCCAAGGGGTGGTGCGTG
TTTGTGTACTTCCGGTCAGTCCACCTCGATGATACGCTCTACGATGAGCCCTACAAGTTC
AACCCATGGAGGTGGAAGGAGAAGGACATGAGCAATGGCAGCTTCACTCCTTTTGGTGGT
GGGCAGAGGCTGTGCCCAGGCCTGGATCTGGCCAGGCTGGAAGCTTCCATCTTCCTTCAC
CACTTGGTCACCAGCTTCAGGTGGGTGGCGGAGGAGGACCACATCGTCAACTTCCCCACC
GTGCGGCTCAAGCGGGGCATGCCCATCAGGGTCACCGCCAAGGAGGACGACGACTAGCCA
CTAGCCACCACTACTACTATACCGATCACCATACTCAACTAGTAGAGGAGATCCATCAGA
TGCATGCATGGATCGATGCAGATCGGTCGGTCGAGTACGAGTAGCCCACACGAGTCGACA
CATGCATGCAACAAGCCAAGTTGCACACACCAAGATGCACATATATATCATCTATATGTC
GATCTATACTGCTACCTACCTATATATATATATATATATATATATATATATATATATATA
TATATATATATATATATATATCACACGTGTACTAGTACTACTCTAGCAAGGGATATGATC
AGGAGGGGCAAGCTCTGAGCAATGGTCCCTGCAAGATGGCCAGTTGCTCTAGCCATTGAT
AGAGGTGCTTACGTATGGTGTAATTATACAGGAAGGGTAGGCCAGCATTAGCTAGGAGGC
AGCTTTGTTAATTTAGCCAACATGTATTGATGTATAAGCTACTGATCGATTAATTAACAG
TACTACTATTGTAGAACTACTGCTCA

CDS

732 bp

>Os01t0197100-02 Cytochrome P450 (Splicing variant)
atggcgaggctgatacagaggatcatccgggagaagagggcaaggagggccgccgcctcg
ccgccgcgggacgccatcgacgtgctcatcggagacggcagcgatgagctcaccgacgag
ctcatctccgacaacatgatcgacctcatgatccccgccgaggactccgtcccggtgctc
atcacgctcgccgtcaagttcctcagcgagtgccctctcgccctgcaccaactggaaGAG
GAGAACATACAGCTCAAGAGGCGAAAAACCGACATGGGTGAGACCTTGCAATGGACAGAC
TACATGTCATTGTCATTCACACAACATGTGATAACAGAGACGCTGCGGTTGGGCAACATC
ATCGGTGGGATCATGCGCAAGGCGGTGCGCGACGTCGAGGTGAAGGGGCACCTCATCCCC
AAGGGGTGGTGCGTGTTTGTGTACTTCCGGTCAGTCCACCTCGATGATACGCTCTACGAT
GAGCCCTACAAGTTCAACCCATGGAGGTGGAAGGAGAAGGACATGAGCAATGGCAGCTTC
ACTCCTTTTGGTGGTGGGCAGAGGCTGTGCCCAGGCCTGGATCTGGCCAGGCTGGAAGCT
TCCATCTTCCTTCACCACTTGGTCACCAGCTTCAGGTGGGTGGCGGAGGAGGACCACATC
GTCAACTTCCCCACCGTGCGGCTCAAGCGGGGCATGCCCATCAGGGTCACCGCCAAGGAG
GACGACGACTAG

Protein

244 aa

>Os01t0197100-02 Cytochrome P450 (Splicing variant)
MARLIQRIIREKRARRAAASPPRDAIDVLIGDGSDELTDELISDNMIDLMIPAEDSVPVL
ITLAVKFLSECPLALHQLEEENIQLKRRKTDMGETLQWTDYMSLSFTQHVITETLRLGNI
IGGIMRKAVRDVEVKGHLIPKGWCVFVYFRSVHLDDTLYDEPYKFNPWRWKEKDMSNGSF
TPFGGGQRLCPGLDLARLEASIFLHHLVTSFRWVAEEDHIVNFPTVRLKRGMPIRVTAKE
DDD*

5'UTR

chr01:5238162..5238266 (+ strand) : 105 bp

CDS

chr01:5238267..5238503 (+ strand) : 237 bp

chr01:5239581..5239670 (+ strand) : 90 bp

chr01:5239781..5239966 (+ strand) : 186 bp

chr01:5240477..5240598 (+ strand) : 122 bp

chr01:5243915..5244011 (+ strand) : 97 bp

3'UTR

chr01:5244012..5244520 (+ strand) : 509 bp

FASTA

>Os01t0197100-02 class=Sequence position=chr01:5238162..5244520 (+ strand)
GTTCTCTCTG TTTCACAATC TTGGATTAAA TGTATACAAT TGCACTCGAT CCATTGCACA TTTTTGACAC ATTATTGTGT
GTGTGGTCAT CAGGCCAAGA AGAAgatggc gaggctgata cagaggatca tccgggagaa gagggcaagg agggccgccg
cctcgccgcc gcgggacgcc atcgacgtgc tcatcggaga cggcagcgat gagctcaccg acgagctcat ctccgacaac
atgatcgacc tcatgatccc cgccgaggac tccgtcccgg tgctcatcac gctcgccgtc aagttcctca gcgagtgccc
tctcgccctg caccaactgg aagtaagcct GTATACCTGA AACCTCTCTT ACAACACAGT AAGCTCTTAA TTGGATCAAT
ACCTGCATAT AATTAGATGC TAGAGATGAA TCCTGAACAG AAAAGAAAAA TAAAACCATA CCCTAGGAAG TAATTAAGGA
TCCTCTGTTG CTGGGCATGG GCAGTCAGCA AAAAGGGTCC AGAACTGAAA AGAGTTGGAT TTTCTTTCTT TTTTGTCTGA
AAGGAACATG ATCAACTATT CATTTTGTCA GAGCCATGTG TTGTGCATGA TATACTACTA TCACTATTGT CTACTACACA
CAATGGCAGA GGATCTGTGT CCCCAAACAA AAACTAGATC ATAAAAAGCC TACGAATAAG GGAGAGATAC GTAGGTGGGC
AGAAGGGATC AGCAGCATAT AAAGGGTTGT GCCAACCTTG GTCCATCCCT TTCTTGTTGG CATCTTAGAG CTATCATTAT
TATTTGTTAT CTAATGTGCC ATCTGAAAAG AAATACTACT ACTACTTGTG TTTGGACCAA TCTTTGCAAG ATGACGTGCG
TTGCATCATT GTCAATGTCA GGTCGGGTAC ATACATATCA TTAGAACAGA GTCGCCTTCT CACAAAAGAA AAGGCTTACT
ATCATGATGT ATCATCTACT TACATATCAT TAGTTTGTGC TATTATGCGT TTTTTTTTTC TAACCGGCTA TAAACGCATG
TGCAAGGAAT AGTTTTTTTG GTTGAAGTAT GGAGGGTTTT TTATCAACTG GGGAAAAAAG AAGGTTACAT AATTTGGCTA
TTTATTCTAT GGAGATTAGA AGGCAGCAGT AATATTTCCT AGCTAGCATG TCCTATTACA CCAGTAGCAT TGTGTCATAT
GCTAGATTCC ATTTACATCA CTACAGTGCT AAGAAATTAC TCGCGTGTCG ACTGTGTTTC TGTTTTGATG CCATGTGAGC
AATAAACTCA TTGAAACCTC TGCATGTCTA CCACTGTTAG AGAACATGCA TATCGCGGCT GAAGATAAAA TCCACCGTCA
GTAATTACTT GTTGTAACAA TGATGAATAA TAACACCAAT CACATTCTAA TGCTACCAGG AGGAGAACAT ACAGCTCAAG
AGGCGAAAAA CCGACATGGG TGAGACCTTG CAATGGACAG ACTACATGTC ATTGTCATTC ACACAACATG TAAGTATAGT
TCATTAACAC TGTAACATAA ATTTCTATAG CTCAAAATCT ACTGGCCCCG TGTGGTTTTT TTCCCATGAC CCCATGCGAT
TTGGAAAATT GGAGTGTAGG TGATAACAGA GACGCTGCGG TTGGGCAACA TCATCGGTGG GATCATGCGC AAGGCGGTGC
GCGACGTCGA GGTGAAGGGG CACCTCATCC CCAAGGGGTG GTGCGTGTTT GTGTACTTCC GGTCAGTCCA CCTCGATGAT
ACGCTCTACG ATGAGCCCTA CAAGTTCAAC CCATGGAGGT GGAAGGTAAG AAAGAGCCCC ACATTTGGTA GAGATGTTCA
TCCAATTGCT ACCCCTTTAG GCAACACCAG CATAATAAGG ATTTGATGAG TGCGGTTTTG GTGGGACTCC TAACATGTGG
GCTTACTTCT ATATCAGTAA TCTCATGATG GATTTGACAT TGCCTTGTAC TAACACTTAG TATTGCAGAA AATAACAGAG
ATTCCCTCAA AGTTGCATTA GTGATTGATA TATACACCTA GGCAGAAGTC AATTGAATCT CCCAAAATAA CTGGATTTGG
TAGTTCTTTG AACTGGTAAA TTCAGACAAC ATAAGCTTAA GCTGTCCAGG AAAGGAATAC ACACCCTTTT TTTCCCTCTA
TTGTGTACTT TGTGTAAGCT CTGAAAATGA TATGCAAATA ATTAATCTAG GCAAATGATG GTGCTGTACT ACTGTTGAGG
CATCCTATCA TTATGATTTG ATTTGGGAAG TCTAATAATG TGCTAATTGG TCAAGAAATC AATCAATCTC AACAGGAGAA
GGACATGAGC AATGGCAGCT TCACTCCTTT TGGTGGTGGG CAGAGGCTGT GCCCAGGCCT GGATCTGGCC AGGCTGGAAG
CTTCCATCTT CCTTCACCAC TTGGTCACCA GCTTCAGGTA TGGATCACCA CATCTCAATC TTGGCCATTC TTAGTGCAGC
CATTGATTCC AACTCCTTAG CTTTGTTTCA TGATCACTTG GCAACAATAG CTTTTTTTTC TTTCTAGATA ATGGAATACA
AACTACAACT TTTGCATAAT TTTCCATGAT CGCTCGGCAC CGATAGCATT TTTTTCTAGA TAAAAGAATA AAAATCACGA
CCTCTACATC ATATAATGAA TGGAATAAAA ATCACGGCCT TTGCATCATA TAATGCACGC AACCGGGCAC CAATGGCATG
CATCTCATGT AGTCATGTCC CTATCATTTG GCCATGCCCT CTTCGCATGC ACATTCATGT TCCTAGTAAT AACTAATCTC
TGTAGAACAA TAGAAGAGCG GAACAGTAGA TGAATTATGC GTTGATTGAC AGAATAATTG TGGGGGGGTA TATAGATCGG
GTACGTACAT GAGGATTTGA AGATCAAGCC GAATCTTTCC AGAGATAAAA AAAAAAGAAA AAAATTATGT CAGATAATAA
CTGGTCCTAA TACGTCACTA GGGATAGCAT CACGAGGCTT TCTCCCATGC TTATACCTCC TCTGTTATCA TCTTCCTTGA
GGGAGTGATC TTACTGTGCT TAAGGAGGTA TCTAAAGCGG TGGTGAAGCC AGCGACATCG TCGAGCCCGG ATAACTAATA
GTGTTTTGTA GTGATCAATC CATTTTTACA CGCGTCAACG GTGATTGGTA GTGGAGACGC CGACAGCGAA GCCTAGACGG
TCGTTCGACC TGGAGCCGTC TCCACCTCTG ATCGAAAGAT ATAGTATGGT ATTTTCGCCT CTCACACTGG GAGATACAAC
TTTCGGCCTA CAAAATCAAC TTCTGGTTTT AAATCTAAGA TATAGATTAT TTCTAGATTC AAGCTTAGAA ATTGTTTTTT
TTAAGAGACA GAGATAGTAC CAAATTCTAT TTCTATAATT TTCTTAAATA CAGTAAATTA TTTCTTCTCG CGAGGAGGAT
TACACTGCGT AGGAACACTA GGTCATTTTT CATGTGAAAG AAAAAAATGG AAGCTACGAG GAAGACAAAT AATTTCGGCG
CGCGGGGCGA AAAAGAAGAA GATCAAGGAA GATACCCAAG GTGGGAGGTC GGTCCAGCCT CTATTGCGAA TAGAGCGGGG
TGTTGTTCCG CGCGTGGGGC CACACGTGCG CGCACATGCG GCGCATATCC ATCCCTTCCC CCCCACACCC ACATGTGTGC
ATGCATGCGG ACTACGCCGC TGTACGCGTG CGTGGCTTAC GGCGCCCGCT GCTACAGCTA CAGCGCCCGC ACGTGTCAGC
TACCACGCCA CGCCCTGCAT GCCCACCGCC GCTGCACCTC CCCTTGAGAC GTGGTCGCTG GGCGGTGGTG GGTCTCACAT
GTCAGTACGT CTTTCGTCAA AAAAAAAATT CAACTTTAAT TTGTTTTTTT CATGGTCTCA CAACCATGTA GCTTACCAAT
GCAAACAGAC TAATCTAAAA AAAAAAAAAT AAGCTTAGCT ATAATGCACG CTTCGATTAA GCAATGTTAC GATGCGTGTG
CTTAGCTCAG GATAGTGCCT ATATTGACAC GAAAATATAC TACATCCATA TAAAAAAATA TAAGCATTTT TTACTATAAA
TTTATATATT TATTCATATT TATAGCTAAA AATACTTATA TTTTGGGTCG GAGCGAGTAT CATATTTTGA TTACCAGTCG
TCCATCAGCT ATGGAGTCTG TATAGGGCTA CGTCCTACGT TCGGGAGGTA GAAAATATGG TGATTTATTT TATTTTTTTG
CGGGGaaata tggtgattta ttaatatatg attaattaag tattagttaa aaacttaaag aataggttaa tataaattta
aaaataattt ttatataaaa aatcgtattg tttagtagtt tagaaaatgt gcCGGATCGG GTTGAGTTGG GAAAGGAGGC
GGGAAGAAGC GTGGTGTAGT AATTGGCGAA GGGGGTAAGA AGGGGGAGAC CGGAGACATG GGTGTGATGG TTAGGCAGCC
GGAATGGGCT CTCTATCGAC TCGAACAGTT GGATGAGATG AGACGAGATG GGTGACATGC GTGCGTGCAT GCATACTTTG
TGCCTTGTCC GGTCCGTGAC TGAACTGAAT CCCAGGAACG CGAATATAAT ACTGTAGCAC GCACGCACGC ACGCACGCAT
CCAGCTGATC TAGCCGGCCG AGATGTGCCA CTTTGACCGG TCGTCAGACA CGCTGCATCA ATGTAGGAGC ACGTGCCAGG
GTATGGTCGC TGCATGCCTG CCTGCAAACA ATACTATACT CCTCCCATAA ACAAATCAAA CTCCAACAAG AGAATCCGAC
TTGCTAGAAA AACATCATAT CACTTTAAAC AATGGAGATT GGAGAGTCCA TCAGTCCAAT GTGTTTTTCT GTCTTCTTTG
ACCATCTTCC AATTCCCCAT TATGCTTGTG CTGACCTCTA TCTAATTGAT CCTAAGAGAA GCGTTTTGCA ACATCTTGTA
AAAAAGCAAA TCACATAATA TTACTCGTGC TTTATGTAGC TAAGCTACAT TGGATCAGGA TCCTCTGCAG TCAAAGTCAC
GTGACTTTGT CACTGACATT GTGGGTCCGA TAATCATTGG GTCCACATGT CTTACAAAGA CAATCCGGCT ACATCATCAT
GCCAGTTTCC GTAATAAATT GACCAGTAAT TTAGTACTAT GGACTTTAGA ACCTGGCACA TGCATAGCAC AGATTCATGC
ATGCGTGCAC TGCATCTGCA CGCATTTGCA TTGGTTGCAC AAGCAGCTAG CTGGCCTACA TATAACATAT TACTGTGTTA
TGCGAGCAAC TGGCCACTGT CCACATGAAG CCAGTAAATC AACTATCAAC ATTGATAGTA GTAAAGCTCT TGTTCAGAGT
TGCAGGCATA TAGGTGCTCC CTGCATGGTT TGCTCAAACT TAAGATAGAT GATACTACAT TCTAAAAATG CAAGTATTTC
TGGTATGTAT CTGGACAAGA TGGTTAGGAC TCTAGCTATA ACATAGAAAA TGCTTATATT AGAATACACT TCATTCGTCT
CAAAATATAA GGTATTTTGA TCGGATATCG ATCCCATCCG GTTAAATACC TTAAGTAGGG AGTGGCAGTG GCATCACCAT
CGATCATGTG TTATTGATAA ATGATTATGA TTATGAGATC TCTTATCTAC AATCTCTTTC TGAATAATCG ACCTGCTGAT
CCATCCATTG CATGCATGGT TGTTGCCTGA CAAGGACATT GAAATGGACT GCTAATTGCT GCCATGGATG CAGGTGGGTG
GCGGAGGAGG ACCACATCGT CAACTTCCCC ACCGTGCGGC TCAAGCGGGG CATGCCCATC AGGGTCACCG CCAAGGAGGA
CGACGACTAG CCACTAGCCA CCACTACTAC TATACCGATC ACCATACTCA ACTAGTAGAG GAGATCCATC AGATGCATGC
ATGGATCGAT GCAGATCGGT CGGTCGAGTA CGAGTAGCCC ACACGAGTCG ACACATGCAT GCAACAAGCC AAGTTGCACA
CACCAAGATG CACATATATA TCATCTATAT GTCGATCTAT ACTGCTACCT ACCTATATAT ATATATATAT ATATATATAT
ATATATATAT ATATATATAT ATATATATAT ATATCACACG TGTACTAGTA CTACTCTAGC AAGGGATATG ATCAGGAGGG
GCAAGCTCTG AGCAATGGTC CCTGCAAGAT GGCCAGTTGC TCTAGCCATT GATAGAGGTG CTTACGTATG GTGTAATTAT
ACAGGAAGGG TAGGCCAGCA TTAGCTAGGA GGCAGCTTTG TTAATTTAGC CAACATGTAT TGATGTATAA GCTACTGATC
GATTAATTAA CAGTACTACT ATTGTAGAAC TACTGCTCA