Os01t0197700-01

Locus

Os01g0197700

Description

Cytokinin oxidase/dehydrogenase, Regulation of grain production

RAP-DB Gene Symbol Synonym(s)

Gn1a, OsCKX2

RAP-DB Gene Name Synonym(s)

Cytokinin oxidase/dehydrogenase 2

CGSNL Gene Symbol

GN1A

CGSNL Gene Name

GRAIN NUMBER 1A

Oryzabase Gene Symbol Synonym(s)

Gn1a, OsCKX2, CKX2, ckx2, Gn1a/OsCKX2, Os CKX2, CKX2/Gn1a

Oryzabase Gene Name Synonym(s)

Cytokinin oxidase/dehydrogenase 2, grain number 1a, cytokinin oxidase 2, Grain number 1a/Cytokinin oxidase 2, Grain number 1 a

Transcript Evidence

AK243684

AB205193 (Koshihikari)

Protein Evidence

Q4ADV8

Literature

PMID: 15976269

Note

Manual Curation

August 2, 2017

Gene Ontology (GO)

Biological Process: cytokinin metabolic process (GO:0009690)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on CH-OH group of donors (GO:0016614)

Molecular Function: cytokinin dehydrogenase activity (GO:0019139)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Functional domain (InterPro)

FAD-binding, type 2, subdomain 1 (IPR016167)

FAD-binding, type 2 (IPR016166)

FAD linked oxidase, N-terminal (IPR006094)

CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 (IPR016169)

FAD-linked oxidase-like, C-terminal (IPR016164)

Cytokinin dehydrogenase 1, FAD/cytokinin binding domain (IPR015345)

Vanillyl-alcohol oxidase/Cytokinin dehydrogenase C-terminal domain (IPR016170)

Full-length cDNA

J100090N07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0197700-01)

Others

Oryzabase (6047)

KEGG (Os01t0197700-01 (EC:1.5.99.12))

Transcript

2147 bp

>Os01t0197700-01 Cytokinin oxidase/dehydrogenase, Regulation of grain production
GCAAGAACACACAAATTCACACACACACTGACACACACAAACCGATCGATTGATTGATTG
ATAATGAAGCAAGAGCAGGTCAGGATGGCAGTGCTCCTCATGCTCAACTGCTTCGTCAAG
GCCACGGCGCCGCCGCCATGGCCGCCGTCGGCTTCGTCCGCCTCCTTCCTCGACGACCTC
GGCGACCTCGGCATCGCGCCGCTCATCCGCGCCGACGAGGCGGGcaccgcgcgcgcctcc
gccgactttggcaacctctccgtcgccggcgtcggggcgcctcggctcgccgccgccgcc
gccgtgctctacccgtcgcgccccgccgacatcgccgcgctgctgcgcgcgtcgtgcgca
cgcccGGCGCCGTTCGCGGTGTCCGCGCGGGGGTGTGGCCACTCGGTGCACGGCCAGGCC
TCCGCGCCCGACGGCGTCGTCGTCGACATGGCGTCGCTCGGCCGCCTGCAGGGCGGCGGC
GCGCGGCGCCTCGCCGTGTCAGTGGAGGGGCGGTACGTCGACGCCGGCGGCGAGCAGCTG
TGGGTGGACGTGCTGCGCGCGTCCATGGCGCACGGGCTCACGCCGGTGTCGTGGACAGAC
TACCTCCACCTCACCGTCGGCGGCACGCTGTCCAACGCCGGCATCAGCGGCCAGGCCTTC
CGCCATGGCCCCCAGATTTCCAACGTGCTAGAGCTCGACGTCATCACCGGTGTCGGGGAG
ATGGTGACGTGCTCGAAggagaaggcgccggacctgttcgacgcggtgctgggcgggctg
gggcagttcggcgtcatcacgcgggcgcgcatcccgctcgcgccggcgccggcgagggcg
cggtgggtgcggttcgtgtacacgacggcggcggcgatgacggccgaccaggagcgcctc
atcgccgtcgatcgcgccggcggcgccggcgcggtgggcgggCTGATGGACTACGTCGAG
GGCTCGGTCCACCTGAACCAGGGCCTGGTCGAGACCTGGCGCAcgcagccgcagccgcct
tcgccgtcctcctcctcctcctcatccttcttctccgacgccgacgaggcccgcgtcgcc
gcgctcgccaaggaggccggcggcgtgctgtatttcctcgagggcgccatctacttcggc
ggcgccgccgggccgtccgccgccgacGTTGACAAGAGGATGGATGTGCTGCGTCGCGAG
CTGCGGCACGAGCGCGGGTTCGTGTTCGCGCAGGACGTGGCGTACGCCGGGTTCCTGGAC
CGCGTCCACGACGGCGAGCTCAAGCTCCGCGCCGCGGGGCTCTGGGACGTGCCGCACCCA
TGGCTGAACCTGTTCCTCCCCCGCTCCGGCGTCCTCGCCTTCGCCGACGGCGTCTTCCAC
GGCATCCTCAGCCGCACCCCCGCCATGGGCCCCGTCCTCATCTACCCCATGAACCGCAAC
AAGTGGGACAGTAACATGTCGGCAGTGATCACCGACGACGACGGTGACGAGGTGTTCTAC
ACGGTGGGGATCCTGCGGTCGGCGGCGGCGGCCGGCGACGTGGGGAGGCTGGAGGAGCAG
AACGACGAGATCTTGGGTTTCTGCGAGGTGGCCGGGATAGCCTACAAGCAGTACCTGCCT
TACTACGGCAGCCAGGCAGAGTGGCAGAAGCGGCACTTCGGTGCCAATCTCTGGCCAAGA
TTCGTGCAGCGGAAGAGCAAGTATGATCCAAAGGCCATCCTGTCCCGTGGCCAGGGGATT
TTCACGTCACCACTCGCATGAAATGACACATGTATGCAAATGCATATCTACATGCGTATA
TATACACGTATATATACGTATGTATGCATACACATATGGGTGTACTGTGCATACGTTATA
GCACACTGCAGCTAATTAAGCTTGACAGGGAGATCGATCAATGGACAATGCTCTAGTCAA
GCTAATATAAATAATGGAGTAGTAGTATATATGTAGTGCGAGATAATTAAGTAGTGTGTT
TGCCTACTAAAAGGAGAGGCAAAGTAGTACTGTGATGCATGCATGCCAACTAATAGGTGA
TAAGTACGTGTGTGTGGCCGCATGTATGATTAGAAGAAGTTGGTTTTTAATTAATTAATT
AGGTCATGTATGTAAATATATAGTACAGTACTACGTACTACTAGTGT

CDS

1698 bp

>Os01t0197700-01 Cytokinin oxidase/dehydrogenase, Regulation of grain production
ATGAAGCAAGAGCAGGTCAGGATGGCAGTGCTCCTCATGCTCAACTGCTTCGTCAAGGCC
ACGGCGCCGCCGCCATGGCCGCCGTCGGCTTCGTCCGCCTCCTTCCTCGACGACCTCGGC
GACCTCGGCATCGCGCCGCTCATCCGCGCCGACGAGGCGGGcaccgcgcgcgcctccgcc
gactttggcaacctctccgtcgccggcgtcggggcgcctcggctcgccgccgccgccgcc
gtgctctacccgtcgcgccccgccgacatcgccgcgctgctgcgcgcgtcgtgcgcacgc
ccGGCGCCGTTCGCGGTGTCCGCGCGGGGGTGTGGCCACTCGGTGCACGGCCAGGCCTCC
GCGCCCGACGGCGTCGTCGTCGACATGGCGTCGCTCGGCCGCCTGCAGGGCGGCGGCGCG
CGGCGCCTCGCCGTGTCAGTGGAGGGGCGGTACGTCGACGCCGGCGGCGAGCAGCTGTGG
GTGGACGTGCTGCGCGCGTCCATGGCGCACGGGCTCACGCCGGTGTCGTGGACAGACTAC
CTCCACCTCACCGTCGGCGGCACGCTGTCCAACGCCGGCATCAGCGGCCAGGCCTTCCGC
CATGGCCCCCAGATTTCCAACGTGCTAGAGCTCGACGTCATCACCGGTGTCGGGGAGATG
GTGACGTGCTCGAAggagaaggcgccggacctgttcgacgcggtgctgggcgggctgggg
cagttcggcgtcatcacgcgggcgcgcatcccgctcgcgccggcgccggcgagggcgcgg
tgggtgcggttcgtgtacacgacggcggcggcgatgacggccgaccaggagcgcctcatc
gccgtcgatcgcgccggcggcgccggcgcggtgggcgggCTGATGGACTACGTCGAGGGC
TCGGTCCACCTGAACCAGGGCCTGGTCGAGACCTGGCGCAcgcagccgcagccgccttcg
ccgtcctcctcctcctcctcatccttcttctccgacgccgacgaggcccgcgtcgccgcg
ctcgccaaggaggccggcggcgtgctgtatttcctcgagggcgccatctacttcggcggc
gccgccgggccgtccgccgccgacGTTGACAAGAGGATGGATGTGCTGCGTCGCGAGCTG
CGGCACGAGCGCGGGTTCGTGTTCGCGCAGGACGTGGCGTACGCCGGGTTCCTGGACCGC
GTCCACGACGGCGAGCTCAAGCTCCGCGCCGCGGGGCTCTGGGACGTGCCGCACCCATGG
CTGAACCTGTTCCTCCCCCGCTCCGGCGTCCTCGCCTTCGCCGACGGCGTCTTCCACGGC
ATCCTCAGCCGCACCCCCGCCATGGGCCCCGTCCTCATCTACCCCATGAACCGCAACAAG
TGGGACAGTAACATGTCGGCAGTGATCACCGACGACGACGGTGACGAGGTGTTCTACACG
GTGGGGATCCTGCGGTCGGCGGCGGCGGCCGGCGACGTGGGGAGGCTGGAGGAGCAGAAC
GACGAGATCTTGGGTTTCTGCGAGGTGGCCGGGATAGCCTACAAGCAGTACCTGCCTTAC
TACGGCAGCCAGGCAGAGTGGCAGAAGCGGCACTTCGGTGCCAATCTCTGGCCAAGATTC
GTGCAGCGGAAGAGCAAGTATGATCCAAAGGCCATCCTGTCCCGTGGCCAGGGGATTTTC
ACGTCACCACTCGCATGA

Protein

566 aa

>Os01t0197700-01 Cytokinin oxidase/dehydrogenase, Regulation of grain production
MKQEQVRMAVLLMLNCFVKATAPPPWPPSASSASFLDDLGDLGIAPLIRADEAGTARASA
DFGNLSVAGVGAPRLAAAAAVLYPSRPADIAALLRASCARPAPFAVSARGCGHSVHGQAS
APDGVVVDMASLGRLQGGGARRLAVSVEGRYVDAGGEQLWVDVLRASMAHGLTPVSWTDY
LHLTVGGTLSNAGISGQAFRHGPQISNVLELDVITGVGEMVTCSKEKAPDLFDAVLGGLG
QFGVITRARIPLAPAPARARWVRFVYTTAAAMTADQERLIAVDRAGGAGAVGGLMDYVEG
SVHLNQGLVETWRTQPQPPSPSSSSSSSFFSDADEARVAALAKEAGGVLYFLEGAIYFGG
AAGPSAADVDKRMDVLRRELRHERGFVFAQDVAYAGFLDRVHDGELKLRAAGLWDVPHPW
LNLFLPRSGVLAFADGVFHGILSRTPAMGPVLIYPMNRNKWDSNMSAVITDDDGDEVFYT
VGILRSAAAAGDVGRLEEQNDEILGFCEVAGIAYKQYLPYYGSQAEWQKRHFGANLWPRF
VQRKSKYDPKAILSRGQGIFTSPLA*

5'UTR

chr01:5275523..5275585 (- strand) : 63 bp

CDS

chr01:5274877..5275522 (- strand) : 646 bp

chr01:5274319..5274785 (- strand) : 467 bp

chr01:5271605..5271870 (- strand) : 266 bp

chr01:5270835..5271153 (- strand) : 319 bp

3'UTR

chr01:5270449..5270834 (- strand) : 386 bp

FASTA

>Os01t0197700-01 class=Sequence position=chr01:5270449..5275585 (- strand)
GCAAGAACAC ACAAATTCAC ACACACACTG ACACACACAA ACCGATCGAT TGATTGATTG ATAATGAAGC AAGAGCAGGT
CAGGATGGCA GTGCTCCTCA TGCTCAACTG CTTCGTCAAG GCCACGGCGC CGCCGCCATG GCCGCCGTCG GCTTCGTCCG
CCTCCTTCCT CGACGACCTC GGCGACCTCG GCATCGCGCC GCTCATCCGC GCCGACGAGG CGGGcaccgc gcgcgcctcc
gccgactttg gcaacctctc cgtcgccggc gtcggggcgc ctcggctcgc cgccgccgcc gccgtgctct acccgtcgcg
ccccgccgac atcgccgcgc tgctgcgcgc gtcgtgcgca cgcccGGCGC CGTTCGCGGT GTCCGCGCGG GGGTGTGGCC
ACTCGGTGCA CGGCCAGGCC TCCGCGCCCG ACGGCGTCGT CGTCGACATG GCGTCGCTCG GCCGCCTGCA GGGCGGCGGC
GCGCGGCGCC TCGCCGTGTC AGTGGAGGGG CGGTACGTCG ACGCCGGCGG CGAGCAGCTG TGGGTGGACG TGCTGCGCGC
GTCCATGGCG CACGGGCTCA CGCCGGTGTC GTGGACAGAC TACCTCCACC TCACCGTCGG CGGCACGCTG TCCAACGCCG
GCATCAGCGG CCAGGCCTTC CGCCATGGCC CCCAGATTTC CAACGTGCTA GAGCTCGACG TCATCACCGG TACGTAGATC
CATCACATCT ACTAAGACAC GCGCCGCCAT GATCGAGGTA ATTAAGGTAT AGGTGTTTTG ACGTATACAT GTATCTGCAG
GTGTCGGGGA GATGGTGACG TGCTCGAAgg agaaggcgcc ggacctgttc gacgcggtgc tgggcgggct ggggcagttc
ggcgtcatca cgcgggcgcg catcccgctc gcgccggcgc cggcgagggc gcggtgggtg cggttcgtgt acacgacggc
ggcggcgatg acggccgacc aggagcgcct catcgccgtc gatcgcgccg gcggcgccgg cgcggtgggc gggCTGATGG
ACTACGTCGA GGGCTCGGTC CACCTGAACC AGGGCCTGGT CGAGACCTGG CGCAcgcagc cgcagccgcc ttcgccgtcc
tcctcctcct cctcatcctt cttctccgac gccgacgagg cccgcgtcgc cgcgctcgcc aaggaggccg gcggcgtgct
gtatttcctc gagggcgcca tctacttcgg cggcgccgcc gggccgtccg ccgccgacGT TGACAAGGTA TACTAGCTAG
CTACTAGCTT GCTCTGCGCT GAGCCGACCA GAGCGGGTCC CACCTCGTGA TGATGGCGGG AACAACTAAG CTGCAAAAAC
TTTTGGCGCC ACCTGGGGCT TACGCTTACG CACGCATGCA ATTAAggggt gttctagatg gggctaaaac tttttagccc
atgtcacatc ggatgtttgg acgctaattt ggagtattaa atatagacta ataaaaaaac taatttcata aatgagagct
aatccgcgag acgaattttt taagcctaat taatctataa ttataaaagt ttattgtagc atcacattgt caaaatcatg
acataattag actcaaaaga ttcgtctcgt gaattagtcc aagatatgga atatgtttta taattagtgt atgtttaata
ctccaaatta gtattcaaac atctggtgtg acatggactt ggaataagtc cgtggaaacc aaacagaccc TAACGGTGCA
TGAAATTGAA GTCTCTTGCG CCGTCGACAT CGTCGTACTT GGCCTACCAC TTTTGTCTGC CACGCGATGC ACCTCTCGCT
ATCACACACC TAACTGGAAG TAATTAAATA ATTATTCGAT TCTGTGTTAA TTTTTTTTTA TCTTCCTTAG TTCCCGGAGA
GACAAAGATT AGATACTATA GTAGCAACTT AGTAAGCTAG TATATGGAGT ATTAGGTTAG TCGCTCTCAC TAAGCTTAAA
CAGGTGTATA AAATATATGC ATCGTCTGAT CGTGACATAT TCTTTTAGCT ACTTATGGTG AAAACTTTTT CGTCCAAAAC
AGTGAAAAGC ATGCGTGCTA GTGTAGGTAG TAGCTACCAG GACGAATTAT ATCATTAACA GTATTTGTAG CACATCAAGG
AAAAACTTGT CTTTTTAAAC ACTGTTACAG TCTTCAGAAC GCACAACTTT AACAGGTATT TTTGTATTAT ATTTTTTTAA
AAAAAAATAA AGGTAATAAA ATTATGGTAT TGTAAAAGTA TATTTTTAAG GAAAATCATA TAACCAATCA AAAGTTTATG
AAGATATACA TATTGATGTT CAAAGTTACT AAAAGTTGAC TTAAACATCA CATTTTCATC TTGACCAAAG AGGGTTCATA
TATATACTCC CTCAATTTTA AAATATAAGC ATTTCTAATT ATATGCATCT AGACAAATGC ATATAAAAAT ACTTTATTTT
TTAAAGTGAG GGAGTATCAA TTTTGAGCAT GTAGCTAGAC TAGATTAGTG TATGTCTACG CACATATCTG TTGTTCTGCA
CAAAACTACT ACTCAtcggt cctaaaatat aagaatttaa aattggatgg gacataccct aatacaatga atttagacaT
GGACATATAC TAGTAATACC ATGtactacc tccatcccaa aataagttca cttttcatcc atctcacaca taccaataga
aagtactaca aatttcggtt attctctatt ttcacaaact ccgatgcaat gattatttta aaaataaact tattttagaa
taaatggaat gagcaaaata taaactggtg tgtttgagga gaaggggatt gaggagattg ggaagatacg caaaacgagg
tgagccatta gctcatgatt aattgagtat taactatttt aaatttcaaa aatggattaa tatgattttt taaagcaact
ttcctatata aaatttttac aaaaaacaca ccgtttaata gtttggaaag cgtacttgcg gaaaacgagg tgctttctcc
ctcaatgtcg tccaaacgaa cGCTGCCTTA TTACGGGACT GAGGAATTAG AGCTTTGCCA GAAAGAAATC AGCATCGCCA
GCTTGGACCT ACCATCCATG CATGCATCAT GTGGCCATTG ACACATCACA TAGTATGTGC TAGCTAGCTA GCTTTTGATC
ATAGTTACAT GTATCTAGCT AGGCTAGAAG CTGGAAACCG ATGGATATGA TGGATCTCTC ATGGATGACA GGCCAGCCAA
AGATCTGTGC GCCACTAGAT ACAGTGCATG CATCAGCTTG TATGGTTATA ACCCTAGCTA GCCAGCTTTA GCACACACAT
GCATATGCAT GCATGAGCCC CCATCTTTTG CAACACGACC GACCAACTAT GTTGGCTCTA TATAGATAGC TAGCTAGTTA
TTCCATGCAT ATACAGTTTG CATTTCCTAG CTATAGCTTT TGCTATGTGA TCCGAGAAGA TCCTGCATGC CCACACGTGA
CACGTCACAC ACACATGTGG ACAAAGTACT GCCTCACTTT ATCCTTGCAT GACGTCACGT CGCCACCTGT CCATCCACGC
TGCTAGTGCT GGCAAAATTA ATAACTCGAT CAAATTTCGG TGATCTCTCT GCAAAGAATT TGATGAATTT TACCAACATA
TATGCTTTAA TTTCTTTGCT TGATTTTATT TGCAGAGGAT GGATGTGCTG CGTCGCGAGC TGCGGCACGA GCGCGGGTTC
GTGTTCGCGC AGGACGTGGC GTACGCCGGG TTCCTGGACC GCGTCCACGA CGGCGAGCTC AAGCTCCGCG CCGCGGGGCT
CTGGGACGTG CCGCACCCAT GGCTGAACCT GTTCCTCCCC CGCTCCGGCG TCCTCGCCTT CGCCGACGGC GTCTTCCACG
GCATCCTCAG CCGCACCCCC GCCATGGGCC CCGTCCTCAT CTACCCCATG AACCGCAACA AGTAATAATA ATAATAAAAA
GCTTTACTAC ATATACACAT GTATATAATT TTTACGGGgt ggattttttc gttcaaaatg acgacccctc atattgtgcg
tgtcgtctga aaacttatta aaatgtttaa ataaaaaatt aatatgatac ataaatatat tatatatcac tatataaaca
ttgtaatctt aaactcaact tgcacaagta gtaaaaaaac aaatttgact gcaaatagtg tgtactaagt tatttattta
cttatgctag tatgctactt gaatttaaac gtacatattt atgaagtggt atattatata tttccagagt atttttatgg
ttcttttacg acatgaaaaa caatgtccgt tctcttgaag gatgaataga ctttccTTAA TTTTAACATA TATGGTGGTA
ACTAAACATA CACACACCTG GATATGTTTC AGGTGGGACA GTAACATGTC GGCAGTGATC ACCGACGACG ACGGTGACGA
GGTGTTCTAC ACGGTGGGGA TCCTGCGGTC GGCGGCGGCG GCCGGCGACG TGGGGAGGCT GGAGGAGCAG AACGACGAGA
TCTTGGGTTT CTGCGAGGTG GCCGGGATAG CCTACAAGCA GTACCTGCCT TACTACGGCA GCCAGGCAGA GTGGCAGAAG
CGGCACTTCG GTGCCAATCT CTGGCCAAGA TTCGTGCAGC GGAAGAGCAA GTATGATCCA AAGGCCATCC TGTCCCGTGG
CCAGGGGATT TTCACGTCAC CACTCGCATG AAATGACACA TGTATGCAAA TGCATATCTA CATGCGTATA TATACACGTA
TATATACGTA TGTATGCATA CACATATGGG TGTACTGTGC ATACGTTATA GCACACTGCA GCTAATTAAG CTTGACAGGG
AGATCGATCA ATGGACAATG CTCTAGTCAA GCTAATATAA ATAATGGAGT AGTAGTATAT ATGTAGTGCG AGATAATTAA
GTAGTGTGTT TGCCTACTAA AAGGAGAGGC AAAGTAGTAC TGTGATGCAT GCATGCCAAC TAATAGGTGA TAAGTACGTG
TGTGTGGCCG CATGTATGAT TAGAAGAAGT TGGTTTTTAA TTAATTAATT AGGTCATGTA TGTAAATATA TAGTACAGTA
CTACGTACTA CTAGTGT