Os01t0197900-01

Locus

Os01g0197900

Description

RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RDR3

CGSNL Gene Name

RNA-DEPENDENT RNA POLYMERASE 3

Oryzabase Gene Symbol Synonym(s)

OsRDR3, OsRDR3a

Oryzabase Gene Name Synonym(s)

RNA-dependent RNA polymerase 3, Probable RNA-dependent RNA polymerase 3

Transcript Evidence

AK105570 (DDBJ, Best hit)

Protein Evidence

Q5QMN5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: RNA-directed RNA polymerase activity (GO:0003968)

Functional domain (InterPro)

RNA-dependent RNA polymerase, eukaryotic-type (IPR007855)

Full-length cDNA

001-128-C12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0197900-01)

RiceXPro (AK105570)

Others

Oryzabase (8344)

KEGG (Os01t0197900-01)

Transcript

1470 bp

>Os01t0197900-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
TAATGGATACTACAGACCCTACCGGAACACTCAGACCTAATGAAGTCTGCGTGATACTTG
AAAATGGCCAGTTTTCTGGAGATGTTCTTGTTTATAAACATCCTGGGTTACATTTTGGTG
ATATACATGTCTTGAAAGCAACATATATTAGGGATCTAGAAAAGGAGTATGTGGGATATG
CTAAATATGCTATACTCTTCCCTATTTCTGGGCCGCGGTCTTTGGCTGATGAGATGGCCA
ACAGTGATTTTGACGGTGACATTTATTGGGTCTCAAAAAACCCAAAGTTATTAGAACACT
TCAAACCTTCTGAACCGTGGGTACAAGCTATTAAACCAAAAAAGACCAAGCAAAAGAAAC
CTCAGGATTGTAATGAATCCAAACTTGAAAGGCTGCTATTTCATGAGTTCTTGAAAACAA
GATTTACTCCCAGTTTTGCACTTGGTACGGCAGCTGATAGCTGGTTAGCATATATGGACC
GACTATTGACAGATTCACTTGACGAAATTGAAAAGAAACTAATAGAGGAAAAGATGCTAA
AGTTAGTTGACCTGTATTATTTGGCTTTGGATGCTCCGAAGACTGGGAACAAGGTCAATA
TTCCAAGTGATCTGATGGTAAAACAATACCCCCACTTCATGGGCCGCAGTTTTTCGTACC
ATTCATCATCCATACTTGGACAAATCTATGATAAAGCAGAAGATGTAGAATCTCTGCGAT
CTTGTAATGTTCAACCAATCGGGGTATCATTGCTCCCATGTTTCATGGAAAGAGAAGCAC
CTCCAGCAGCCAGGCACCTCTGGCAACACCGCTACGAGGAGTACTTGACTGACAGTACAA
TGCTCTATCGCGCAATGGTAGATAAAGAAGAAAGGAACATGAAGTTCCAAGAACTCTACG
AGAAGTACAAGCATATGCTCTACGATGCATCTGAATTCGAGCAGACACAGAGGGACCCCG
ACGACGTGTTCTCGGAAGCCTGCGTGATCTACCAGATTGTGTATGAGAAAGCACGGTGGA
GCAACGACGCCAGCAGGTGTGGCTTCGCCTGGAAGGTCGCCGGCCGCGCGCTGTGCCACT
TCTACGCGCTCAAGAACGAGGGTGACACCGCGCTCTGCTCGCTTCCACTTCTTCGCAAGA
TCATCAAGAAGGATCATCGCAGGTAGAGTGTCGTGTTTATGGACTACTACCACCAAATTA
ACTATCTATTGTATCAAGTATGTGTGTACTGTAGCAGTAATGTTAGGAGCAGACTTTTTA
AGCTGGTGATTTAGCACTTCTCATGAACATGTGGGACAAAGTACTACTAGAAAAATTATT
ATGGGCCATGTTTATACCGGCATGGCTGCTTCAAGTGAACCTGCTGTAGTGAACTAGTGA
TTATCTGTAAGCGCAGTGTCCAGTGTGACAATGGGCACAAGTATGCATCACTGTTGGTGT
GCAAAATGGACAGCATGGATTCTGTATGGT

CDS

1164 bp

>Os01t0197900-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
ATGGATACTACAGACCCTACCGGAACACTCAGACCTAATGAAGTCTGCGTGATACTTGAA
AATGGCCAGTTTTCTGGAGATGTTCTTGTTTATAAACATCCTGGGTTACATTTTGGTGAT
ATACATGTCTTGAAAGCAACATATATTAGGGATCTAGAAAAGGAGTATGTGGGATATGCT
AAATATGCTATACTCTTCCCTATTTCTGGGCCGCGGTCTTTGGCTGATGAGATGGCCAAC
AGTGATTTTGACGGTGACATTTATTGGGTCTCAAAAAACCCAAAGTTATTAGAACACTTC
AAACCTTCTGAACCGTGGGTACAAGCTATTAAACCAAAAAAGACCAAGCAAAAGAAACCT
CAGGATTGTAATGAATCCAAACTTGAAAGGCTGCTATTTCATGAGTTCTTGAAAACAAGA
TTTACTCCCAGTTTTGCACTTGGTACGGCAGCTGATAGCTGGTTAGCATATATGGACCGA
CTATTGACAGATTCACTTGACGAAATTGAAAAGAAACTAATAGAGGAAAAGATGCTAAAG
TTAGTTGACCTGTATTATTTGGCTTTGGATGCTCCGAAGACTGGGAACAAGGTCAATATT
CCAAGTGATCTGATGGTAAAACAATACCCCCACTTCATGGGCCGCAGTTTTTCGTACCAT
TCATCATCCATACTTGGACAAATCTATGATAAAGCAGAAGATGTAGAATCTCTGCGATCT
TGTAATGTTCAACCAATCGGGGTATCATTGCTCCCATGTTTCATGGAAAGAGAAGCACCT
CCAGCAGCCAGGCACCTCTGGCAACACCGCTACGAGGAGTACTTGACTGACAGTACAATG
CTCTATCGCGCAATGGTAGATAAAGAAGAAAGGAACATGAAGTTCCAAGAACTCTACGAG
AAGTACAAGCATATGCTCTACGATGCATCTGAATTCGAGCAGACACAGAGGGACCCCGAC
GACGTGTTCTCGGAAGCCTGCGTGATCTACCAGATTGTGTATGAGAAAGCACGGTGGAGC
AACGACGCCAGCAGGTGTGGCTTCGCCTGGAAGGTCGCCGGCCGCGCGCTGTGCCACTTC
TACGCGCTCAAGAACGAGGGTGACACCGCGCTCTGCTCGCTTCCACTTCTTCGCAAGATC
ATCAAGAAGGATCATCGCAGGTAG

Protein

388 aa

>Os01t0197900-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
MDTTDPTGTLRPNEVCVILENGQFSGDVLVYKHPGLHFGDIHVLKATYIRDLEKEYVGYA
KYAILFPISGPRSLADEMANSDFDGDIYWVSKNPKLLEHFKPSEPWVQAIKPKKTKQKKP
QDCNESKLERLLFHEFLKTRFTPSFALGTAADSWLAYMDRLLTDSLDEIEKKLIEEKMLK
LVDLYYLALDAPKTGNKVNIPSDLMVKQYPHFMGRSFSYHSSSILGQIYDKAEDVESLRS
CNVQPIGVSLLPCFMEREAPPAARHLWQHRYEEYLTDSTMLYRAMVDKEERNMKFQELYE
KYKHMLYDASEFEQTQRDPDDVFSEACVIYQIVYEKARWSNDASRCGFAWKVAGRALCHF
YALKNEGDTALCSLPLLRKIIKKDHRR*

5'UTR

chr01:5292957..5292958 (- strand) : 2 bp

CDS

chr01:5292901..5292956 (- strand) : 56 bp

chr01:5291963..5292191 (- strand) : 229 bp

chr01:5291021..5291166 (- strand) : 146 bp

chr01:5290537..5290696 (- strand) : 160 bp

chr01:5289913..5290060 (- strand) : 148 bp

chr01:5288935..5289107 (- strand) : 173 bp

chr01:5288440..5288691 (- strand) : 252 bp

3'UTR

chr01:5288136..5288439 (- strand) : 304 bp

FASTA

>Os01t0197900-01 class=Sequence position=chr01:5288136..5292958 (- strand)
TAATGGATAC TACAGACCCT ACCGGAACAC TCAGACCTAA TGAAGTCTGC GTGATACTGT TAGTTACAGA ATTACCCCTT
TTGCATCTGC ATATCCTTTC AGCGGTTTTT ATATGTATCA GTGATCCTCA GTTTACTATT CACCAGTCAC CATATAGCAT
AGGAATATCC ACTATCCAGC ATGGACACCA CTGGAACTGC TTTAATGTCT TGTAATTTTG TTTAGTAGAA ATGCACCAAA
ATTGCCATGC TTTCTTCCAA GTTCTTGCTG ATTAGCACCA TAAATTTTGC ACTTTAACAA GGTGAGATGG AGTTTTTGCA
ATTTCCTTTT AGCAATGAGA ACGCATTTTT GTATTCAAAC AATTATATAT TGCTGGCAAT GATTTTGATT GCAATTGTGA
AGTTCGTTGG TAAACAGCGG CTAAAGAAAA TGTTTAGACT AGTAACTTAT GATACTAAAT ACATCTGGGT ATTTGGGGCT
TCAGGACTTC AATTGCATTT TTAAGTTCAT TTTCCCAAAT TTAGACTAAC TTGAACATGT AGTCTTTTAG ACATCAGGAA
ATCTGTGTGA CTGTTTTTAA TAAATAGAAA AAAAATCTCA AATAGAAGAT ATTATGGATT ATTAAAAGGT TTTGAATTTG
TCAATGTTAA GAACTAATGT TCTTTGTCAT ATTTCTTCCT TGCATCCATT GGTTGGTACT GTATCACTTA TGTTTGATCG
CATTCTGGTT TGTTCTTTAC TTATTAGCTT TATCTGCTGT TCAACAGTGA AAATGGCCAG TTTTCTGGAG ATGTTCTTGT
TTATAAACAT CCTGGGTTAC ATTTTGGTGA TATACATGTC TTGAAAGCAA CATATATTAG GGATCTAGAA AAGGAGTATG
TGGGATATGC TAAATATGCT ATACTCTTCC CTATTTCTGG GCCGCGGTCT TTGGCTGATG AGATGGCCAA CAGTGATTTT
GACGGTGACA TTTATTGGGT CTCAAAAAAC CCAAAGGTTT GTTAATTTCT AATTGACATT TTGCCTTATT GTGCCTTTGT
GCTTGATTAT CTTTCATTCT CATTAAAATC CGTAGTGAAG TTTTGCTTGG TTCCACCCTC GTTCATAGTG TAGTTGTTCC
ATCCATATGG CCGTGATGCT ATTTTAACTA TGGTCTATAT TTATTGAGTC TATCCATGTA GTCTTCTTGG AAACACTCTC
TTCTTTGTAA GAAAAGTGGC CCTTGTTAAA CCTTAAGGGC AAAATTGGAC CTTTTGCCAA ACATGtgtta tgggcaaggt
ttcatagagg ataaacaccg ccaagtggat agctggaagg tgttggcttg gttgggatgC CAGTTAGACA TGAGGGGTTA
ATTTGGTTAC CAAACTAAAT AATATTGCAT GCCTTCATGT TTAATGAGGA AAGTGTCCAT TTTACAACCC TGATCTTCAG
ACCTAAAAAG TGGACCCTTT TCCTAAATTT AGACTATCGA AGCCATTCAC TTTTCACCTT TTAAACTTGG CCCGAATGTA
GAATGGTTTC AGGTGGCCAA TCGCTAATGA AGCCCAAGTT CAGTGGCCAA AAGTGTTGGA ATATTGACCT ATCCGTTTTA
ATTATGCTTG CTAGTTCTTG GACTGATTAC AGATTTGCTG TGCATGATTC ATTAGTAAAT TTGGCATTGT TGTTTCACTG
TATCTTTAAA TTATAATTCT TGCATAATAA GGTACTGATA TAATAACAGC ACATTCTGTC TTTAACTTTT GAAAGAATTA
TTGCTGACTG ATCCTGAAAA TGTTCTTTTC AGTTATTAGA ACACTTCAAA CCTTCTGAAC CGTGGGTACA AGCTATTAAA
CCAAAAAAGA CCAAGCAAAA GAAACCTCAG GATTGTAATG AATCCAAACT TGAAAGGCTG CTATTTCATG AGTTCTTGAA
AACAAGATTT ACTCCCAGGT ATTAATACCA AGCTTGATTT TTCTGATGCA CAGTAATAAT TGTCACCAGC CTTCCTTTTT
GGAATGGTAA CTAGAACCAT TTCACTATAA AGAAAACTTA GCAGCATGAA TCTCATTTAG TTTTTAGTAG GCAATTTATT
GAGGAGTTCA GCACTTGATT GAATTCAATA TTCTAGAAGT GCTTGAATTT CTTTTTATAT GAACCTGATC AGTACATTTT
TAAAAATCTA GTTTTGGTGA CCTCCTGTAG TATTTCAATA TATGCAACCT TTATTGGTTT TATACAATCT AACATGATTT
TGGAGTTCTT TTCTCCTTTC AGTTTTGCAC TTGGTACGGC AGCTGATAGC TGGTTAGCAT ATATGGACCG ACTATTGACA
GATTCACTTG ACGAAATTGA AAAGAAACTA ATAGAGGAAA AGATGCTAAA GTTAGTTGAC CTGTATTATT TGGCTTTGGA
TGCTCCGAAG ACTGGGAACA AGGTTAGTTC CAATCTTGGG CTTACACATT CTTCAGTTTC AAATGCTTTT ACACAGTACT
GAATCCTTAT TACAATGATT CATGAACGGA TGAACCAAGT GTAGTTATCT GAACAACTCG TGATTCATTA CAATGATTCA
TAAACTGCCA ATATTTTATA CGGATAGCTG CAGTGGGTGT CCAGTACATA GTAATAAGCT GATTATTGGA TAATGTTGTA
ATTAACATAG TTCAATATAA GTTAGAAATG GACCAGCTAC CCGGTGTCCA GGGCACCATG GTGGTTGGAA TAGTTGCATG
GTGACAGGAA TACGTTTAAC GTATGAAGCA GTGAGATCAA GTAGGGCTAC AAGATAAAGA TAATAGATGA AATGTGCAGG
TGTATCTTTA TTATTTTATA TTTGATGCTT TGTAAGACCA AAGTTCATTA CATGGGAATG CATATTGCAC TTCAACAGTT
TATGTGCTGT CCCAACAGGT CAATATTCCA AGTGATCTGA TGGTAAAACA ATACCCCCAC TTCATGGGCC GCAGTTTTTC
GTACCATTCA TCATCCATAC TTGGACAAAT CTATGATAAA GCAGAAGATG TAGAATCTCT GCGATCTTGT AATGTTCAAC
CAATCGGTAT GTTGTCTGTT TTATTTAGGT TCCTTTTTTC AGTTCTTTTA TAGTTTTATC TGCAGTAGGG AGATGACATA
CATTATTTGT TCTGCTTGTA GCACATAGGC TATAACTTAT GAGCTGAGCT TGCAGTAGTT AAGGTATTGC CAAATGGCAA
GCATATTGAG AAAATGTGAT GTTGTTCTCA GTATATACAT ATGTGGTATC ATGGAAAGGG TCTATGCCAT TTTTTAAAAA
AAAACGGTTT GCATTCATTG CATGAAAAAA TGATTAATTG TAAGGCAGTC AATTAATTGG AAATAGTAAT TAATAAACCA
TTATAGTTTC ATGTTTATAT ATATTAATTT ATTTATAGAA GTGATGATGA ACAATTACAT CTATTCTAAT TAGTTACCTA
CGCACATAAG GATAATCTTA AATTATAATA GTTTACACTT ATTCAGACCT AGAAATAAGT TGTGGAAAGA TTTATTTCTA
AAATTGTATT AAAAAGTTAC AAAAAAAATC ATCTGCTGTT TTTAATTATG GAGAAGACTA TCTACTTATG CACTCAACCG
TTAATTTTTT ACTCATATGG TCCACCTAGT TTCAAAACAA AATGAATGGG AGGGAGAGAT GTCAAAATTG TTCAATGAGA
GAAGCAGAGG TTAGTTACCA TTCTGCAGAA GCACTAGACA TGATTTTGGC ATAGAACACG GTTTCAATTA AATTGGTTTC
ATATGTTTGA TGAGAATAGT ACTATAATAT GAATGTTCTC TCTAACAGTA TGCCTTACTT TTTTCCCTCT TTTCCTTTTT
ACAATAATAA GGGGTATCAT TGCTCCCATG TTTCATGGAA AGAGAAGCAC CTCCAGCAGC CAGGCACCTC TGGCAACACC
GCTACGAGGA GTACTTGACT GACAGTACAA TGCTCTATCG CGCAATGGTA GATAAAGAAG AAAGGAACAT GAAGTTCCAA
GAACTCTACG AGAAGTACAA GCATGTGAGT ATCCATCCAA ATTTCCTGAG TAACAGCGTT TTCAATGGTC GAATTAATTA
CAGCTAGCTT TTTAACCTAA CGAACCCTAT CTCGCCGCCT GGGTGGCGCG GTAATTAGCC CTTAGTCGGG CTGTGGCCCT
ATGTTTGTAC ATGTTTGTTT TCTGTACGGT TTTATTCTTC TCTATTCAAT GAAATTGGCG GCTCGCCGTT TTCGTTTTAA
CCTAACGAAC CCTTGAACCT GCTGCAGATG CTCTACGATG CATCTGAATT CGAGCAGACA CAGAGGGACC CCGACGACGT
GTTCTCGGAA GCCTGCGTGA TCTACCAGAT TGTGTATGAG AAAGCACGGT GGAGCAACGA CGCCAGCAGG TGTGGCTTCG
CCTGGAAGGT CGCCGGCCGC GCGCTGTGCC ACTTCTACGC GCTCAAGAAC GAGGGTGACA CCGCGCTCTG CTCGCTTCCA
CTTCTTCGCA AGATCATCAA GAAGGATCAT CGCAGGTAGA GTGTCGTGTT TATGGACTAC TACCACCAAA TTAACTATCT
ATTGTATCAA GTATGTGTGT ACTGTAGCAG TAATGTTAGG AGCAGACTTT TTAAGCTGGT GATTTAGCAC TTCTCATGAA
CATGTGGGAC AAAGTACTAC TAGAAAAATT ATTATGGGCC ATGTTTATAC CGGCATGGCT GCTTCAAGTG AACCTGCTGT
AGTGAACTAG TGATTATCTG TAAGCGCAGT GTCCAGTGTG ACAATGGGCA CAAGTATGCA TCACTGTTGG TGTGCAAAAT
GGACAGCATG GATTCTGTAT GGT

Locus: Os01g0197900

Loading...

Locus: Os01g0197900

Loading...