Os01t0198000-01

Locus

Os01g0198000

Description

RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RDR4

CGSNL Gene Name

RNA-DEPENDENT RNA POLYMERASE 4

Oryzabase Gene Symbol Synonym(s)

OsRDR4, OsRDR3b

Oryzabase Gene Name Synonym(s)

RNA-dependent RNA polymerase 4, Probable RNA-dependent RNA polymerase 4

Transcript Evidence

AK064209 (DDBJ, Best hit)

Protein Evidence

Q5QMN4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: RNA-directed RNA polymerase activity (GO:0003968)

Functional domain (InterPro)

RNA-dependent RNA polymerase, eukaryotic-type (IPR007855)

Full-length cDNA

002-104-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0198000-01)

Others

Oryzabase (8345)

Transcript

2121 bp

>Os01t0198000-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
CAGGACATTGTGGATTGTGCTGCAAGCAAATTGATGGGGTCTAACAACACCACTGAATAT
CCTCTTCTTATTCAACTCCGCCTGTTCTACAATGGATCTGCTGTAAAGGGAACAGTCCTA
GTTGACAAGCGGCTTCCTCCTAGGACTATACATATCCGACCATCAATGTTAAAAATAAAA
ACTTATCCAGAATTATCTGGTGTCCAATCTGTCAACTCATTGGACATAGTCTCTGCACGA
AATGCCAAGAAAAGTCTATCTGGGGTTCAGTCCGTGAATTCTTTTGAAATAGTCTCTACA
AGCAATCGATCAGGAAGGACATTCACATCAAATAATTTAATTGCATTACTTCACTATGGA
GGAGTTCCAGAAGAATTCTTTATGGAGCTTCTGCAGACTGCGATTGAAGAGGCTGACAAT
GCTCGTTTTGATTATGCTGGCGCACTGAACATTGCATTCAACTATGCTGACATGGAAGAT
TCAATGCCAGCACGGATGATTCTTTCCGGAATCCCACTAGAAGAGTCGTACTTGCAATCT
AGGCTGGATTTCTTGTCTCTACTGGAAAGAAAAGGAATCAAGAATGGAAAGATACCAATT
GATGACTGCTATTATTTGATGGGTACTGCAGACCCTACAGGAAAACTTGGACCTAATGAA
GTCTGCGTGATACTTGATTATGGCCAAGTTTCTGGAGATGTTCTTGTGTATAAATATCCT
GGCTTACATCCTGGTGATATACATGTCTTGAAGGCAACATATAGTAGCGACATAGAGAAG
GTTGTGGGAAATTCTAAACATGCGATACTCTTCCCTACTACTGGACAACGGTCTTTGGCT
GATGAGATGGCCAATAGTGATTTTGATGGTGACATCTACTGGGTCTCATTAAACCCAAAG
CTGTTAGAACATTTTAAACCTTCGAAACCATGGGTTCCAGCTATTACACCAAATGGGACC
AAGCAAAAGGGACCCGAGGATTTTAATGAATCCGAGCTTGAAAGAGTGCTATTTCATGAG
TTCTTGAAAACAAGATTTGCACCTAGTTATGCGCGTGCTACGGCAGCTACTAACTGGTTA
GTATATATGGATCGGCTATTAACTGTTTCACTTGACGAAAGTGAAAAGAAACTAATTGAG
AAAAAGATGCTCAAGTTAGTTGACCTTTATTATTTGGCTTTGGATGCTCCAAAGATGGGG
AACAAGGTCAATATTCCACGTGATCTAATGGTAAAACAATACCCCCACTTCATGGACCGC
AGTCCTTCGTACCATTCGTCGTCCATACTTGGAAAAATCTATGATAAAGCAGGTGATCCA
AAACCGCTGCGATCTGATAATGTTCAACCAACCAGTATATCATCGCTCCCATGTTTCGCG
GAGAGAGACGTGCCTCCAGCAATCAAGCAACTCTGGCAACACCGCTATAACGAGTACTTG
GCTGATAGTTCACTTCTCTATGCCGAAGAGGCGGATGAAGAAGAAAAGAAGATAAAGTTT
CAGGAACTCTATGAAAAGTACAAGCATTTGCTCTACGGTGCATCTGAATTTGAAGAGACA
CCGAGGGACCTCGACGACGTGTTCTCCGAGGCCTGTGCAATCTACCAGATCGCGTATGAG
AAAGCACGGTCTGCCAACAACGTCGCCAGATGTGGCTTCGCTTGGAAAGTTGCCGGCCGT
GCATTGTGCCATTTCTACACGGTCAAGAATGAGGGTAACGCTGTGGTTTGCTCGCTCCAA
CTTCTCCGCAACTTCAGATTTACCAAGAAGTACCGCAAGTGAAGTAGCATCGCATTTAGG
GATAGTTAATTTGTATGAAGTTTGGCGTATGTAGTATTGTAACAGCAATATAGGAGCAGG
AGCGGACTAATAAGGACTTCTTAAGCTGATGGTTTAGTAGGAAAATGTCAGGACAGACTT
TATAACTAAGCTGATGGGCCTATTAACATGGCTGCTTGAAGTGAACACAAGCAGTCAAGC
TAAAGATTGCTACGTTAGCTCTGGAATCATTTCAGCATGCATGCATGCATCATGTATCAC
TGAACAAATGCACATTCAGAGCTTGCATGACTGACATGTGAAGTCTAAATGAAATATCAA
GAGCTTGCATATTCAGAGTGG

CDS

1782 bp

>Os01t0198000-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
CAGGACATTGTGGATTGTGCTGCAAGCAAATTGATGGGGTCTAACAACACCACTGAATAT
CCTCTTCTTATTCAACTCCGCCTGTTCTACAATGGATCTGCTGTAAAGGGAACAGTCCTA
GTTGACAAGCGGCTTCCTCCTAGGACTATACATATCCGACCATCAATGTTAAAAATAAAA
ACTTATCCAGAATTATCTGGTGTCCAATCTGTCAACTCATTGGACATAGTCTCTGCACGA
AATGCCAAGAAAAGTCTATCTGGGGTTCAGTCCGTGAATTCTTTTGAAATAGTCTCTACA
AGCAATCGATCAGGAAGGACATTCACATCAAATAATTTAATTGCATTACTTCACTATGGA
GGAGTTCCAGAAGAATTCTTTATGGAGCTTCTGCAGACTGCGATTGAAGAGGCTGACAAT
GCTCGTTTTGATTATGCTGGCGCACTGAACATTGCATTCAACTATGCTGACATGGAAGAT
TCAATGCCAGCACGGATGATTCTTTCCGGAATCCCACTAGAAGAGTCGTACTTGCAATCT
AGGCTGGATTTCTTGTCTCTACTGGAAAGAAAAGGAATCAAGAATGGAAAGATACCAATT
GATGACTGCTATTATTTGATGGGTACTGCAGACCCTACAGGAAAACTTGGACCTAATGAA
GTCTGCGTGATACTTGATTATGGCCAAGTTTCTGGAGATGTTCTTGTGTATAAATATCCT
GGCTTACATCCTGGTGATATACATGTCTTGAAGGCAACATATAGTAGCGACATAGAGAAG
GTTGTGGGAAATTCTAAACATGCGATACTCTTCCCTACTACTGGACAACGGTCTTTGGCT
GATGAGATGGCCAATAGTGATTTTGATGGTGACATCTACTGGGTCTCATTAAACCCAAAG
CTGTTAGAACATTTTAAACCTTCGAAACCATGGGTTCCAGCTATTACACCAAATGGGACC
AAGCAAAAGGGACCCGAGGATTTTAATGAATCCGAGCTTGAAAGAGTGCTATTTCATGAG
TTCTTGAAAACAAGATTTGCACCTAGTTATGCGCGTGCTACGGCAGCTACTAACTGGTTA
GTATATATGGATCGGCTATTAACTGTTTCACTTGACGAAAGTGAAAAGAAACTAATTGAG
AAAAAGATGCTCAAGTTAGTTGACCTTTATTATTTGGCTTTGGATGCTCCAAAGATGGGG
AACAAGGTCAATATTCCACGTGATCTAATGGTAAAACAATACCCCCACTTCATGGACCGC
AGTCCTTCGTACCATTCGTCGTCCATACTTGGAAAAATCTATGATAAAGCAGGTGATCCA
AAACCGCTGCGATCTGATAATGTTCAACCAACCAGTATATCATCGCTCCCATGTTTCGCG
GAGAGAGACGTGCCTCCAGCAATCAAGCAACTCTGGCAACACCGCTATAACGAGTACTTG
GCTGATAGTTCACTTCTCTATGCCGAAGAGGCGGATGAAGAAGAAAAGAAGATAAAGTTT
CAGGAACTCTATGAAAAGTACAAGCATTTGCTCTACGGTGCATCTGAATTTGAAGAGACA
CCGAGGGACCTCGACGACGTGTTCTCCGAGGCCTGTGCAATCTACCAGATCGCGTATGAG
AAAGCACGGTCTGCCAACAACGTCGCCAGATGTGGCTTCGCTTGGAAAGTTGCCGGCCGT
GCATTGTGCCATTTCTACACGGTCAAGAATGAGGGTAACGCTGTGGTTTGCTCGCTCCAA
CTTCTCCGCAACTTCAGATTTACCAAGAAGTACCGCAAGTGA

Protein

594 aa

>Os01t0198000-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
QDIVDCAASKLMGSNNTTEYPLLIQLRLFYNGSAVKGTVLVDKRLPPRTIHIRPSMLKIK
TYPELSGVQSVNSLDIVSARNAKKSLSGVQSVNSFEIVSTSNRSGRTFTSNNLIALLHYG
GVPEEFFMELLQTAIEEADNARFDYAGALNIAFNYADMEDSMPARMILSGIPLEESYLQS
RLDFLSLLERKGIKNGKIPIDDCYYLMGTADPTGKLGPNEVCVILDYGQVSGDVLVYKYP
GLHPGDIHVLKATYSSDIEKVVGNSKHAILFPTTGQRSLADEMANSDFDGDIYWVSLNPK
LLEHFKPSKPWVPAITPNGTKQKGPEDFNESELERVLFHEFLKTRFAPSYARATAATNWL
VYMDRLLTVSLDESEKKLIEKKMLKLVDLYYLALDAPKMGNKVNIPRDLMVKQYPHFMDR
SPSYHSSSILGKIYDKAGDPKPLRSDNVQPTSISSLPCFAERDVPPAIKQLWQHRYNEYL
ADSSLLYAEEADEEEKKIKFQELYEKYKHLLYGASEFEETPRDLDDVFSEACAIYQIAYE
KARSANNVARCGFAWKVAGRALCHFYTVKNEGNAVVCSLQLLRNFRFTKKYRK*

CDS

chr01:5317221..5317280 (- strand) : 60 bp

chr01:5317064..5317135 (- strand) : 72 bp

chr01:5316345..5316514 (- strand) : 170 bp

chr01:5315054..5315202 (- strand) : 149 bp

chr01:5314652..5314874 (- strand) : 223 bp

chr01:5313482..5313707 (- strand) : 226 bp

chr01:5310694..5310839 (- strand) : 146 bp

chr01:5310197..5310356 (- strand) : 160 bp

chr01:5309223..5309370 (- strand) : 148 bp

chr01:5308107..5308279 (- strand) : 173 bp

chr01:5307754..5308008 (- strand) : 255 bp

3'UTR

chr01:5307415..5307753 (- strand) : 339 bp

FASTA

>Os01t0198000-01 class=Sequence position=chr01:5307415..5317280 (- strand)
CAGGACATTG TGGATTGTGC TGCAAGCAAA TTGATGGGGT CTAACAACAC CACTGAATAT GTATTGTATT AACTATAAGA
TGTTCTGATT TACCCCTTTT CTGTTTTTTC TATGTTTGTT ATTCTTATCT ATTTTATTTT TCTAGCCTCT TCTTATTCAA
CTCCGCCTGT TCTACAATGG ATCTGCTGTA AAGGGAACAG TCCTAGTTGA CAAGCGGGTA TGCACTGTTT TCTAAGACAA
TTAGTTTGTA AGCAGGTTTG GTATCAAAAT AATTTCTTCA GGATTACCTC TTTATTCCAA TCTTGGTTCA TAGTTGCTTG
AACATCTATA TATTAGCGCC TTCCATATGT TTGTGCCGTA CAATCGGAGA TTGTCTAGTA CGGGTCTTGC AATTTAATTT
CATAATTTTT TATTTATTTT TTAGAACACG CAGGAGAATT TCATAATATA TGATTATGTA AAAGTAGTAT ACAAGAAGAG
CCGTATTTAT CCGTGCTTCA TTCAGGATAG GTGTGCTATT TCTTGCATCT CATCATTTCC TAAGACCGCC TGATCATTTC
TTTGTTTGTT CATGTTGACA TAATCTTTGC TGATATCCTC TTATTGTCAT AGTTGCACTG GCCGAGTGGC CTTCACTGTC
TTCACCAATA TATGCATTGT TTACATAATT TTGAAGTGTA CAGATCATGT CCTTTTTCTA TCTTATCTTG ACTGACCTTA
TATCTTGAGT GTACTTTATA AGAAATAATA AAGTCTCCTG TTGCAGCTTC CTCCTAGGAC TATACATATC CGACCATCAA
TGTTAAAAAT AAAAACTTAT CCAGAATTAT CTGGTGTCCA ATCTGTCAAC TCATTGGACA TAGTCTCTGC ACGAAATGCC
AAGAAAAGTC TATCTGGGGT TCAGTCCGTG AATTCTTTTG AAATAGTCTC TACAAGGTAT GCCAAATATC TGAGTTGCAT
TGCTATGTTA GGTATGGTGA ATAATGGCTT AACACATATT AATGCTTTGT ATTGCATGCC TACATCTTTT TAGATCCTCT
GCAGAGTATA ATTATGCTAT CAAGTAGCAT TATTTTCATC CCTTTCGTTT TTTTAGTTAT ACGTCACGCA TCACGTGTCA
TCTTTCGTAA GTGTGGTTGA AGCCAGAAAC TTTGAGATGT TAGTTTTGCC TACGGTCGCT GTTAGTTTTT TTTGAGTATT
TCCAGTGCAT CCTCTTTTAG GCAACGCAAA TGGCCATGAA AAACTGCAAA CAAGGAAAAC ACTGGCTTTG CAATTCATGA
TATAATCAGG CATGTACGAA ATTTCAGCTT AAAATCCATG ATGTGCTAGG ATAAACACAG AGGACAAATT TTGGTGAATT
GTAGATCTCT CTCTCTCTCT CTCTTCTCTA AAGCCCAGGA GAATTGTGCT TCATTTCATT AAGACGGAAA CAAAAAATAT
ATAAGAAAAA TAATTAAAAA AATGGTGAAT TGTATCTCTC TCTCTCTCTA TCCAGATTTC CTATACGGCA GAATGAATTT
TGATTTGAAA ATTTGATGCT GATAGATTGA TTTTTTGTCA AGGTTGCCAT TGCCATTCTT CTTTTCCAGA GTTTTTCAGG
ACCATCCACA CAACCCACCC AGATATATTT TTCCCAATTT CTGCTACAGT TGCTATGAGG TGGCATAACT TGGAAATCAG
AACAACAAAA TACGTTTGAT GTGTTAGATG TGAAACTCAC TTTTTTTTTT CTATAAATAG GATTACTTGC CTTTGCTTAG
TAATTTGAGT TTAGGTTTTT GGATGAGTTG TTGGTACATG AAACTCAGAT GTCCAAAGGA ACGAACTCTG CATTTAAATC
ATTGTGGTAT TTGGGATTTT GGGTGGGCTG GTGGCCAGAC TTGGAGGTTC CTTACTGTGG TTTAAGTGCT GTCACATGTC
TAATCCTCAT GGTTGGGGCC GGTTAGGTAG AGGCAGGAGG GAGAGTAAAG CTGAGCTCAT TAGGTAGGTG TGTAAGGGGT
AGTAAAGCTT TTTGATTGGC AACAGGCAGT CAGTTCTATT TTTTGTTCAC AGTAAGTAAT ATCATTTCTT TTTCTCAGCA
ATCGATCAGG AAGGACATTC ACATCAAATA ATTTAATTGC ATTACTTCAC TATGGAGGAG TTCCAGAAGA ATTCTTTATG
GAGCTTCTGC AGACTGCGAT TGAAGAGGCT GACAATGCTC GTTTTGATTA TGCTGGCGCA CTGAACAGTT AGTTCGAACT
ACCCTCATTG CATTGCACTG TGTTCTGTAC AATTTGTATA TATGTGCTTC TTCATTCTGT AGAACCTGTA CTCATCTTAC
TAGTTGTAAT AGAGTTACTA TTTTCTTTAT ATTTTTCAGT CACCTGTCCG TGTTTGATCC GGACTAATAT TCTCATGTTC
TTGCAGTTGC ATTCAACTAT GCTGACATGG AAGATTCAAT GCCAGCACGG ATGATTCTTT CCGGAATCCC ACTAGAAGAG
TCGTACTTGC AATCTAGGCT GGATTTCTTG TCTCTACTGG AAAGAAAAGG AATCAAGAAT GGAAAGATAC CAATTGATGA
CTGCTATTAT TTGATGGGTA CTGCAGACCC TACAGGAAAA CTTGGACCTA ATGAAGTCTG CGTGATACTG TTAGTAATGG
AAATACTCTT TTGCTTCTTC TTGGTGTTTG AGTGTGTGTT TTTTTGTTAT GCTTCAGTGA TCCTTTGTTA CCACATAAGA
TAGGAGTATC ATTATCCACC ATGGGCATCA TTGGAACTAC TTTAATGTCT TACAGTCTTC TTTAGTTGTA ACGCACCAAC
ATTACCATTT TTCTTACTAT TTACAATCCT CAATTTTGAA TCACAACTCA AAGGTTAGAT TGGTTGGCAT GTATTCTCTT
TTCGCAACCG GACTGTATTT TTTATTCAAA CTATCCGAAA ATAGTGGCAA CAATATTGGT TGCAATTGTG AATTTTGTCA
GCAAATGGAG TCTAAAGAAA GTATTGAACT GACAACATAA GATCATAAAT ACATGTCATG TATTTGGACC CTCGAGACTT
TAATGCCATT CTTTAGTTCA TTCAACCTAA TTTTGAATTT CTTGAGTATA TCTGTATATG GCCTTTTTTA GCTCAGTAAT
TTGATCTGTT TAATTGTTTT TAATAGTTAG GAAAAAAAAT TCTACCAACA GATACTActg tttttcaata gatgacgaca
ttgattattg atagaacgtt tgaccattca tcttattaaa aaatttagtg taaataacga aaatataatt catgcttaaa
gtttttttaa tgataaaaca acttgcaaca aaataaatga cacttgtata atttttttga aaaagaagaa tggtcaaatg
tcatgccaaa agtcaatgat gtcagctatt aaaaaatggg gagagtaTAT TGGATTACGA AAAGGGGTTT GAATTTGCCA
AAGATAATAA CTTTGTTCTT TGCTATATAT ATTCCTTGCA TAAATGTGCA TCAATATACA AGTATTAATT TGTAGCGTGC
CTGTTATGTT TTGGGTCTTT CTTTACTTAT TTGCTTTATA TGTGGTTAAA CAGTGATTAT GGCCAAGTTT CTGGAGATGT
TCTTGTGTAT AAATATCCTG GCTTACATCC TGGTGATATA CATGTCTTGA AGGCAACATA TAGTAGCGAC ATAGAGAAGG
TTGTGGGAAA TTCTAAACAT GCGATACTCT TCCCTACTAC TGGACAACGG TCTTTGGCTG ATGAGATGGC CAATAGTGAT
TTTGATGGTG ACATCTACTG GGTCTCATTA AACCCAAAGG TATGTTAATT CCTGATTGAC ATTTTACCGT GAAGTTTATT
GGAAATCATC GTCTTGGGAG ATGCACCTAA TATTGTTTTT GTGCTTGATT ATCTTTTATG GTCAGCAAAA TCCCTGACAG
AGTTTTGCTC AGTTGCCCCT AGTCCACAGC GTAGTTGTTC CATTCATACA GCAGTTATGC TACTTTACCC ATGGTCTATG
TCGATTGTAT TTATCCAGTA ATGCTCTTGG AAATGATCTG TTCTTTATAA GAGAAGTGTC CGATGTTATA ACTCCAGGAA
AAATGGCTCT TTCGCCAAAC CTGAGGAGCT AATTTGGTCA CTGCACCCAA ACCAAATGAT ATTAAATGTC ATAGCTCCTT
TGCTTTTAGA AGAATTCAGT TATTAGTATG CTTAGGTTTT AATGAGGAAA AGGCTTGTTT TACAACATTA ACCTCAAACC
TCAAAAGTAG ACACTATTCA AAATCTGGAC GATCAAAATC ATTCACTTTA TACCTTAGCC TGAATCGGAT TGTTTTTACA
TGACATTCAT TAAGGTGGCA GTAAGGGCCA AGGTTGAAAT TATTTTTGAA TTTTTGGAAT TAGTGAGTTG ACATAAAAAA
TATGGACAAA TTCTTTAGTC GCACCTTGGA GTATAGTTAG TCTCAAGTGA AACAGAGTAT ATTTTAGTCA GTGAAATGAA
AATTGGCTTA TTTAGTTTTG AACACACCTT TTTCCAGATG CTTATACTTT ATTTTTCTCG TACTAAATTT TCTAGGCTAT
ATATACACCA TAATATTATT GAGAATTTTC CAGAACTGAT TCAGGTGTTT TCTGATTCTG AATGTTAAAA AATATACACC
AGGTATAAAT GGTTTTTGAA TTTTTTATGA TAACTAAATG ACTTAAATTT TCTTTTTGAT TGGTTGTTGG GAGTATTGAA
AACTTGGATA AATTAGTCGA ACATTTATAT AAATTTGTAG GTATTTATTT TTTAACATTA TTTTTGAAGG GCCAGTTATA
CTTTATCTAG GTCCACTGTA CTGGTTAGAG GTTTCCAGAA CGTTTTGAAA TAGTTTACTA AGTCAGTTTA AAATTGGTTC
GGCCTTGGGT GACATCGTCA TGTTGCCAAA ACAGGTCTGC ATTTGGGGTG AACTTGAAAG GTGATTGGTT TTGAAGTTCA
GGGTGGTGTT TAAGACCAGT AAAGTCCACT TGGGAAAATA TTTTCTCGTA AACGCAGGAG AGAAAAAAAA TCCATTTCAT
TAAGAAGAAG TATAACACAC TTACAAGTTA CAAACGAGGG TTTACGAAAA CCCTCCCACA AAAAACACAC CACGGAAGGT
GACGCACGAC CACACCTTCA AGGACAACCT AGCTGCCCGA GGCAAGCAAC CTACAGAGGA ACTCTTGGAG CGCATGCTCT
CCAGCTAGAC ACCACAAACT AGCCTCGGTT GTGGTGGTGG ACTCACAACC TACAGAGGAC TTGATCCATT GAACATGTaa
tcattctggt ctttccaaat ctcccaatct actacgataa tcaacgagtt caacccctta cgctgctcct taggaatctc
cttgacaacc ttccaccacc atcctgaaaa atgggatact gaaaggctga ggggccgcat ccaccaatcc caatttaaga
tcaaggtcca tacttttcct ggaaaagaca catgagacaa gaatatgctt catggtttca tcctcttgat gacataggcc
aggtgtggta agccacactt ggctagacgg tctgatgtcg aacatcgatt gtcgactgcc aatcacaagg aaaaattatg
ttgtggagga acccaacttc tctaaattcg ctcccaagtt gcaaacttga ttgataagta agcattgtat gcgacttact
tgtgtagaac ttgtaagctt ctatctatgc tcatccagaa catcttgttg caagattatc ccatccacca agtcccaaat
atgtagatac tcacaaataa cctgaattgt gagttcttta atatcagcca cccatatcct attaaccaat tcctttgcca
cagtgcgttg cttccttact cttcggggaa ttgtctcaag aaggttaggg tccaattcag ccaatgtttt gcgcagccat
atatcagtcc agaacttggt gttctcccca ttaccaatta tagtttccgt agctacgtag aagagcgcat gaacattgtg
acttgtgaga tacttggata ggcaagctga cccatggtct agaagaatca attatttgaa gcctttctag gttatgtatg
tcaagaccac aatactgtat tggccggcaa acatgttccc aagacaaaag acagttgctt tatcctgtcc tttccaaaga
aatcctctgc ttttcttata atagctttga acgcccattt gggtggatcc atagccatct taaggtagat agggTCCTAG
GGTAGCTGTT TTTTTAGTTA TGCCATGTTT GCTTTTTGTT GCAAAATTGT GCATCGCTGT TTCATTGTGT CTTTGCATTG
TTTCACTATA TGTTTGCTTA TTATTCTTGC ATGTATATGG TTTTGATATA TAACAGCACA TTCTCTCTTT TGAGCTTTTC
AAAGATTATT GCTGCTCTGA TAATAAAAAT GGTCTTTTCA GCTGTTAGAA CATTTTAAAC CTTCGAAACC ATGGGTTCCA
GCTATTACAC CAAATGGGAC CAAGCAAAAG GGACCCGAGG ATTTTAATGA ATCCGAGCTT GAAAGAGTGC TATTTCATGA
GTTCTTGAAA ACAAGATTTG CACCTAGGTA TTAATACCAA GCTCAGTTTT TCTAATGTAT ATTTTTCATT AGGAAACCAT
TTCTCTACTG TAAAGAAATT TACCTCATTT AACTTCTAGT ATATACAACT TATTGAGGTG TTCAATACTT CAATGGATGT
CCTCCCATGC GCCAATGATG ATCCCTTGAC CGAATTCAAT ATTTTTATAA CTACAAGTGC TTGGGTATCT TTTTGTATGA
ATCCGATTAG TACATTTTTA AATATCTAAT GTTGGTGACA ATTTTCTGTA GCTTTTTAAT ATATACAACC TTATAAGTTT
TGTACGATCT AACATGAGTT TGGATTTCTT TTTTCTCCTT TCAGTTATGC GCGTGCTACG GCAGCTACTA ACTGGTTAGT
ATATATGGAT CGGCTATTAA CTGTTTCACT TGACGAAAGT GAAAAGAAAC TAATTGAGAA AAAGATGCTC AAGTTAGTTG
ACCTTTATTA TTTGGCTTTG GATGCTCCAA AGATGGGGAA CAAGGTTAAC TTCAATCTTG GGCTTACACA ATGTTTGTTG
CAAATGCTTT TACATGGAAC TGAAATCCTT ATTAACTTAT GCTTTCATCT GGTATTTTGA TAAACACCGG AAAGAAGGAA
ACAAATTGAA CCAAGACCTT GTAGTAATAA TTAGTTAATA ACACCTTGAT TAAGTTTGGA GTGAAATCAA TTGGACTATT
CTTATATACA TGTCAACATA TGAACTGAAC TACTTATGAA ATCATACTGA GGAATGTGCT GACAAGTCAG CCTATCCAAT
TCAATCCATA TATGCTATTG GGTAGTGCGT GTGAAGGTTA TTAGTTGCTA TTATATTCTA TTCTGGTAGT AAGTACTACA
AAATTATAGC AAAATCAGTC ATATGCACCT GAATGTTGCT ATCTGCTGTG GATACACTAC ACTGGTCTTG ATGTACATAG
TTATGAAGTC ACTCTTTTAT TAAATTAATA TACCATAACA TGATGATTCT TTGTTCCATT AGTTGCGTCT TGATTGTGGT
TGTGTGAACT TTTAACCATA TGTGTTAACT CTCGGTATAT TAGCGTGATT TAAGAATGGA TGTACCATGC TTAGTTATGG
GAATAACTCG TTGGTATTTC ATATTTGGTT CTTATATATT ACTTTTTATA TGTACAGATG CATGGCCACA TGAATGCATT
TGACATATGA AGCAGTCAGA TTAAGTAAAA TTACAAGATA CAAAATGAAA TGTGCAATTG CATCTTTAGT TATTTGAAGC
TTTGTAATGT GAGGGTATTG AATGCATATT GTGCTTTAAC AATTTAAGCT TTGCCCACCA ATCCCGACAG GTCAATATTC
CACGTGATCT AATGGTAAAA CAATACCCCC ACTTCATGGA CCGCAGTCCT TCGTACCATT CGTCGTCCAT ACTTGGAAAA
ATCTATGATA AAGCAGGTGA TCCAAAACCG CTGCGATCTG ATAATGTTCA ACCAACCAGT AAGTTGTCTT TATTTAGCTC
CCTTCTTTTT TCAATTTGTT TATCTGTAGT AGGGATACTC CACACATTCT CTCTATTCTA CCTGTAGCAC ATAGTAGGCT
ACAACTTAGC TTGAGCTTGC AGCAGTTAAG GTGGCAATGA GGATGTTGAT ATTAATAAAT ATAtatttcc tccatttcac
aatgtaagac tttctagcat tgtccacatt catttagatg ctaatgaatc tagacatgtg tatgtgttta gattcattag
catctatatg tactccctcc gtcccataat ataagggatt ttgagttttt gcttgcactg tttgaccact cattttatta
aaaaaatttg gaattattat ttattttttt gggacttact ttattatcca aagtacttta agcacaactt ttcgtttttt
atatttgcat aaattttttg aataagatga gtggtcaaac aatacaaaca aaaactcaaa atcccttata ttatgggaca
gagggagtaT ATTGGTAATG CTAGAAAGTT TTACATTGTG AAACGGAGGG AGTATGTGTT ATCATGGAAA GAGTTTAGGA
CTCTAGGTCA GTTTTGTGAG ACTATAGGAT CATATTCGTA TAATTTATAT GTAAAATTAA TGGAGAACAA TTACATCTAT
TCTAATAAGT TGTCTGTGTA TAACCCATGG TATGCTGTAT GTCATCACTT TTTTTTTCTA TTTAACTTTC AAAAACAAAC
GCTGCAAAAA ATTTTGGCCA TGCCATCCGA TGTGGTGTGC TTCGCAACAT TTAGAACAAC TCATGATTTT GGCACAGAAC
ACGGTTGATG TGAATTGTGA TGTGGTGTCA CAAGCAGGTT TCATATATTT GATGAGACAA GTACTTTATG AATGTTCTCT
GTAACATGAC ATTCCTTTTC TCTTTTGTTT TTGATAATAA GGTATATCAT CGCTCCCATG TTTCGCGGAG AGAGACGTGC
CTCCAGCAAT CAAGCAACTC TGGCAACACC GCTATAACGA GTACTTGGCT GATAGTTCAC TTCTCTATGC CGAAGAGGCG
GATGAAGAAG AAAAGAAGAT AAAGTTTCAG GAACTCTATG AAAAGTACAA GCATGTGAGT GTCCTGTATT CTTTTGAATA
CCAGCTTTTT TTTTCCTAAT GGTTGGAAAA CAGCTTCAGA GTTCTGACCC AATCGCTCTT GCCAACATTC AGTTGCTCTA
CGGTGCATCT GAATTTGAAG AGACACCGAG GGACCTCGAC GACGTGTTCT CCGAGGCCTG TGCAATCTAC CAGATCGCGT
ATGAGAAAGC ACGGTCTGCC AACAACGTCG CCAGATGTGG CTTCGCTTGG AAAGTTGCCG GCCGTGCATT GTGCCATTTC
TACACGGTCA AGAATGAGGG TAACGCTGTG GTTTGCTCGC TCCAACTTCT CCGCAACTTC AGATTTACCA AGAAGTACCG
CAAGTGAAGT AGCATCGCAT TTAGGGATAG TTAATTTGTA TGAAGTTTGG CGTATGTAGT ATTGTAACAG CAATATAGGA
GCAGGAGCGG ACTAATAAGG ACTTCTTAAG CTGATGGTTT AGTAGGAAAA TGTCAGGACA GACTTTATAA CTAAGCTGAT
GGGCCTATTA ACATGGCTGC TTGAAGTGAA CACAAGCAGT CAAGCTAAAG ATTGCTACGT TAGCTCTGGA ATCATTTCAG
CATGCATGCA TGCATCATGT ATCACTGAAC AAATGCACAT TCAGAGCTTG CATGACTGAC ATGTGAAGTC TAAATGAAAT
ATCAAGAGCT TGCATATTCA GAGTGG

Locus: Os01g0198000

Loading...

Locus: Os01g0198000

Loading...