Os01t0200300-01

Locus

Os01g0200300

Description

Similar to Homeobox-leucine zipper protein HOX29.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HOX29

CGSNL Gene Name

HOMEOBOX GENE 29

Oryzabase Gene Symbol Synonym(s)

Oshox29, OsHox29, OSHB5, HB5

Oryzabase Gene Name Synonym(s)

rice homeobox gene 29, Homeobox-leucine zipper protein HOX29, Homeodomain transcription factor HOX29, HD-ZIP protein HOX29, HOMEODOMAIN CONTAINING PROTEIN 5

Transcript Evidence

AK112091 (DDBJ, Best hit)

Protein Evidence

Q5QMZ9 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

MEKHLA (IPR013978)

Full-length cDNA

002-107-A01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0200300-01)

Others

Oryzabase (8466)

Transcript

1429 bp

>Os01t0200300-01 Similar to Homeobox-leucine zipper protein HOX29.
GCGTCGACGATGTTTGCATCTCTGTCAATTCATCCAAAGTGATCGGTTGCAATGCAACAT
TCAGCAGTGGACTCCCTATTGTCAGTACCGGTGTTCTTTGTGCCAAGGCATCCATGCTGT
TGCAGGATGTCTCTCCTCCATCACTACTGCAATTTTTGCGCGAACACCGGTCACAGTGGG
CCGACAGCAATTTAGACGCATTCTTCGCCTCCACGATGAAACCAAACTTCTGCAATTTAC
CCATGTCCCGTCTTGGAGGATTCAGTGGTCAGGTCATACTTCCTTTAGCACACACGTTTG
AACCTGAAGAGTTCCTGGAAGTTATCAAGCTAGGAAACGCCAGCAACTACCAAGATACAC
TGGTGCACCGTGATCTGTTCCTCTTGCAGATGTACAATGGAGTAGAGGAGAGCAGTGCAG
GAACATGTTCAGAGCTCATCTTTGCGCCCATCGACGCATCGTTCAGTGATGATTCCCCAC
TGCTGCCTTCCGGTTTCCGCATCATCCCAATCGATTCTCCTCTCGACACGTCGAGCCCGA
ACTGCACGTTGGATCTCGCGTCCACGCTCGAAGCCGCGACGCCACGGAGCAGGATCAGCG
GCGTCAATGGCGGCGGCGGCGGCTGTGCTGCTGCTGCGGCGAGCTCTAGCTCCAAGGCGG
TGATGACGATCGCGTTCCAGTTCGCGTTCGACGGCCACCTGCAGGACAGCGTGGCCGCCA
TGGCGCGGCAGTACATGCGCAACATCATCTCGTCGGTGCAGAGGATCgccgtggcgctct
cgtcctcccgcctcgtccctcccggcgccggcgccgccgccgcgcagctctcaccggtga
ctccggaggcggcgacgctgcccAGATGGATTTGCCAGAGCTACAGATTTCATTTTGGAG
ATGAACTCATCAAATCTGTAGATGCAAACAGCAGCAATGAATCGATTCTGAAAGCAGTTT
GGCATCATCCGAGTGCCATACTCTGCTGCTCTCTCAAGGCGATGCCAGTGTTCACATTTG
CAAACCAGTCTGGCCTCGACATGCTCGAAACAACTCTGGTGGCGCTCCAAGACATGACGC
TGGAGAAAGTTTTCGACGATCAAGGGAGGAAGAACCTGTGCACAGAGCTCCCCAACATCA
TGGAGCAGGGGATGGCGTGCATGGAGGGAGGGGTGTGCGTGTCGAGCGTTGGGAGGGCGG
CGTCGTACGAGAAGGCGGTGGCGTGGAAGGTGGTCGACGGCGACGGCGGCGGCGCCCACT
GCATCTGCTTCATGTTCATCAACTGGACCTTCCTTTGATTTCATTTCATTATACACCCCA
ATGCAAAACGGATATATAATATTACAACTAGTGCAATTTACGTACGTAATCTCATGAAAC
AGCGTGTACAAATGTTTTGGATTTTGAGAACCGCGGTGCTAGTTTTTGT

CDS

1296 bp

>Os01t0200300-01 Similar to Homeobox-leucine zipper protein HOX29.
GTCGACGATGTTTGCATCTCTGTCAATTCATCCAAAGTGATCGGTTGCAATGCAACATTC
AGCAGTGGACTCCCTATTGTCAGTACCGGTGTTCTTTGTGCCAAGGCATCCATGCTGTTG
CAGGATGTCTCTCCTCCATCACTACTGCAATTTTTGCGCGAACACCGGTCACAGTGGGCC
GACAGCAATTTAGACGCATTCTTCGCCTCCACGATGAAACCAAACTTCTGCAATTTACCC
ATGTCCCGTCTTGGAGGATTCAGTGGTCAGGTCATACTTCCTTTAGCACACACGTTTGAA
CCTGAAGAGTTCCTGGAAGTTATCAAGCTAGGAAACGCCAGCAACTACCAAGATACACTG
GTGCACCGTGATCTGTTCCTCTTGCAGATGTACAATGGAGTAGAGGAGAGCAGTGCAGGA
ACATGTTCAGAGCTCATCTTTGCGCCCATCGACGCATCGTTCAGTGATGATTCCCCACTG
CTGCCTTCCGGTTTCCGCATCATCCCAATCGATTCTCCTCTCGACACGTCGAGCCCGAAC
TGCACGTTGGATCTCGCGTCCACGCTCGAAGCCGCGACGCCACGGAGCAGGATCAGCGGC
GTCAATGGCGGCGGCGGCGGCTGTGCTGCTGCTGCGGCGAGCTCTAGCTCCAAGGCGGTG
ATGACGATCGCGTTCCAGTTCGCGTTCGACGGCCACCTGCAGGACAGCGTGGCCGCCATG
GCGCGGCAGTACATGCGCAACATCATCTCGTCGGTGCAGAGGATCgccgtggcgctctcg
tcctcccgcctcgtccctcccggcgccggcgccgccgccgcgcagctctcaccggtgact
ccggaggcggcgacgctgcccAGATGGATTTGCCAGAGCTACAGATTTCATTTTGGAGAT
GAACTCATCAAATCTGTAGATGCAAACAGCAGCAATGAATCGATTCTGAAAGCAGTTTGG
CATCATCCGAGTGCCATACTCTGCTGCTCTCTCAAGGCGATGCCAGTGTTCACATTTGCA
AACCAGTCTGGCCTCGACATGCTCGAAACAACTCTGGTGGCGCTCCAAGACATGACGCTG
GAGAAAGTTTTCGACGATCAAGGGAGGAAGAACCTGTGCACAGAGCTCCCCAACATCATG
GAGCAGGGGATGGCGTGCATGGAGGGAGGGGTGTGCGTGTCGAGCGTTGGGAGGGCGGCG
TCGTACGAGAAGGCGGTGGCGTGGAAGGTGGTCGACGGCGACGGCGGCGGCGCCCACTGC
ATCTGCTTCATGTTCATCAACTGGACCTTCCTTTGA

Protein

432 aa

>Os01t0200300-01 Similar to Homeobox-leucine zipper protein HOX29.
VDDVCISVNSSKVIGCNATFSSGLPIVSTGVLCAKASMLLQDVSPPSLLQFLREHRSQWA
DSNLDAFFASTMKPNFCNLPMSRLGGFSGQVILPLAHTFEPEEFLEVIKLGNASNYQDTL
VHRDLFLLQMYNGVEESSAGTCSELIFAPIDASFSDDSPLLPSGFRIIPIDSPLDTSSPN
CTLDLASTLEAATPRSRISGVNGGGGGCAAAAASSSSKAVMTIAFQFAFDGHLQDSVAAM
ARQYMRNIISSVQRIAVALSSSRLVPPGAGAAAAQLSPVTPEAATLPRWICQSYRFHFGD
ELIKSVDANSSNESILKAVWHHPSAILCCSLKAMPVFTFANQSGLDMLETTLVALQDMTL
EKVFDDQGRKNLCTELPNIMEQGMACMEGGVCVSSVGRAASYEKAVAWKVVDGDGGGAHC
ICFMFINWTFL*

5'UTR

chr01:5429389..5429390 (- strand) : 2 bp

CDS

chr01:5429266..5429388 (- strand) : 123 bp

chr01:5428989..5429174 (- strand) : 186 bp

chr01:5428812..5428889 (- strand) : 78 bp

chr01:5428578..5428712 (- strand) : 135 bp

chr01:5428120..5428481 (- strand) : 362 bp

chr01:5427853..5427964 (- strand) : 112 bp

chr01:5427302..5427451 (- strand) : 150 bp

chr01:5426713..5426862 (- strand) : 150 bp

3'UTR

chr01:5426582..5426712 (- strand) : 131 bp

FASTA

>Os01t0200300-01 class=Sequence position=chr01:5426582..5429390 (- strand)
GCGTCGACGA TGTTTGCATC TCTGTCAATT CATCCAAAGT GATCGGTTGC AATGCAACAT TCAGCAGTGG ACTCCCTATT
GTCAGTACCG GTGTTCTTTG TGCCAAGGCA TCCATGCTGT TGCAGGTTAG CTTCACTATG AAACTAGAAT TAATATTTTT
TTTGTTTGGT TGATCATGTC CAGTTTTTTT CATACAATAT TTCTGCTGTT TGCTAGGATG TCTCTCCTCC ATCACTACTG
CAATTTTTGC GCGAACACCG GTCACAGTGG GCCGACAGCA ATTTAGACGC ATTCTTCGCC TCCACGATGA AACCAAACTT
CTGCAATTTA CCCATGTCCC GTCTTGGAGG ATTCAGTGGT CAGGTCATAC TTCCTTTAGC ACACACGTTT GAACCTGAAG
AGGTAAGTTC ATCTTCTACT GTCTGTCAGT TACATAAAAG GTCCTGTCCA ATTCTGTCCT CCTGCTCAAT TATTTTGATG
CAACCATCTA TTGTTTTTCA GTTCCTGGAA GTTATCAAGC TAGGAAACGC CAGCAACTAC CAAGATACAC TGGTGCACCG
TGATCTGTTC CTCTTGCAGG TGACTTCTTG ATTCATGAGA CTTATCACCA GTTGAAGAAT CATTTTCTTT TTTTTTTCCT
CTGTAAAACT TGTGTTCTTG GCCTGATTGC AATGGCAGAT GTACAATGGA GTAGAGGAGA GCAGTGCAGG AACATGTTCA
GAGCTCATCT TTGCGCCCAT CGACGCATCG TTCAGTGATG ATTCCCCACT GCTGCCTTCC GGTTTCCGCA TCATCCCAAT
CGATTCTCCT CTCGTAAGTA AATCTCACAC AATAGTTTCA AATCAAATCT TCTGAATTTT TATGTTTAAA AAGAAGTTGT
TCTGAATATT CTTTCCCTGC AAATGTCAGG ACACGTCGAG CCCGAACTGC ACGTTGGATC TCGCGTCCAC GCTCGAAGCC
GCGACGCCAC GGAGCAGGAT CAGCGGCGTC AATGGCGGCG GCGGCGGCTG TGCTGCTGCT GCGGCGAGCT CTAGCTCCAA
GGCGGTGATG ACGATCGCGT TCCAGTTCGC GTTCGACGGC CACCTGCAGG ACAGCGTGGC CGCCATGGCG CGGCAGTACA
TGCGCAACAT CATCTCGTCG GTGCAGAGGA TCgccgtggc gctctcgtcc tcccgcctcg tccctcccgg cgccggcgcc
gccgccgcgc agctctcacc ggtgactccg gaggcggcga cgctgcccAG ATGGATTTGC CAGAGCTACA GGTCTGTGGC
TTCGCAGCTG CTTGTGTGAT ACAGTTCATA TCTGTCAAGA AATTTTCACT TGCCATCATC GCAAGATTTT TTAAAAAAAG
TTCACTCTTT TTTGAACGAA AAAAAAAAGT TCACTCTTCA TAACTGATGA TGCTATGCTT ATACAGATTT CATTTTGGAG
ATGAACTCAT CAAATCTGTA GATGCAAACA GCAGCAATGA ATCGATTCTG AAAGCAGTTT GGCATCATCC GAGTGCCATA
CTCTGCTGCT CTCTCAAGGT TTCTTCAGCC CCCTTTTTTT CTTATTTAGA TACAGATTTT ATCTTAATTT TTATAAGCAT
GTTAATTAAA CTGTTAAACT GTATATTTCG TACGAAAATT TTTATATAGA AACTTTAAAA TATAAGATAA ATCTATTTTT
AAATTTAAAT AATTAAAATT TAATTAACGA GATGTTAAAT GTTAATAACT TTCTCATTTT ACCTGTCCGT AATCTTTTAT
CTTAAACTCG AATGGGGCCA GTACTCATAC TGCTATGCAT GGAGGATTGT TTGTTCTCTG AATTTATTTC CGGGACTTAT
GAATCTTTGC TACAGCTCGA CTGAAATTTT GTTTTGACAC AAATTCACCT TAAAGTTGAC AGTGTAACGC ACCATTTAAC
CATCTGATTT TTCATGTAGG CGATGCCAGT GTTCACATTT GCAAACCAGT CTGGCCTCGA CATGCTCGAA ACAACTCTGG
TGGCGCTCCA AGACATGACG CTGGAGAAAG TTTTCGACGA TCAAGGGAGG AAGAACCTGT GCACAGAGCT CCCCAACATC
ATGGAGCAGG TATAATCATA TCACAAACTG ACATGAGATA AGTACTAATG CAAAAATTAT TTTTCATACA TAAAAAAAGA
TACttttaga ttaataagta attttgactt tgatcaaaat taaactactt caagtttgat caagtttgat taattaagtt
tgtagataaa tatagtaata tttacaacac caaattagtt ttattaaatt aataattaaa tatattttta taatatattt
gttttaggtt aaaaatgtta ctactttttt cagtttgact ttgaccttaa gtcaaaaatg agttataatc taaaatggag
cgagtaCATT ACATGGAATG CATTAATAAT CTTATCATCT TATCAATAGA AGATACAGTA AGATTTCACC GAGGCTTTCA
TCAGTTGCAA ATTGATTAAT TAGTGGCACG CGATTAACTA AATTGCAGGG GATGGCGTGC ATGGAGGGAG GGGTGTGCGT
GTCGAGCGTT GGGAGGGCGG CGTCGTACGA GAAGGCGGTG GCGTGGAAGG TGGTCGACGG CGACGGCGGC GGCGCCCACT
GCATCTGCTT CATGTTCATC AACTGGACCT TCCTTTGATT TCATTTCATT ATACACCCCA ATGCAAAACG GATATATAAT
ATTACAACTA GTGCAATTTA CGTACGTAAT CTCATGAAAC AGCGTGTACA AATGTTTTGG ATTTTGAGAA CCGCGGTGCT
AGTTTTTGT

Locus: Os01g0200300

Loading...

Locus: Os01g0200300

Loading...