Os01t0206700-01

Locus

Os01g0206700

Description

Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK05

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 5

Oryzabase Gene Symbol Synonym(s)

OsCIPK05, CIPK5, OsCIPK5, OsSTA7, OsSnRK3.2, SnRK3.2

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 5, Sucrose nonfermenting-1-related protein kinase 3.2

Transcript Evidence

AK065589 (DDBJ, Best hit)

Protein Evidence

Q9LWM4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

NAF/FISL domain (IPR018451)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J013031K24 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0206700-01)

Others

Oryzabase (7392)

Transcript

1922 bp

>Os01t0206700-01 Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).
ACAAACACCTGGCCTATTTTTAGGCATCCTCTTCCATCTCCAGAGAAGTGAGCCCCAGCC
TCATGTCACAAGGGAAGCACTAGCCACCATAGAACTCTCTCTCTTTTTCTCCTTCCTCCT
AGGAGGATCCCAAATACACCAATCGTGTCTTGGATTTTCCCAAACACAGCGCGCACTCTC
GCCCTTCACCTCTCCTCCCTCTCACCCTTCCATTACATGGATCAGGGAGGGAGGAAGGAG
GCCTGAAGTGGCGCAGAGTAGGCGCTTGTAAACAAATCCCCCCATTTGCTTCTTTTGCAC
TGAAGAATCCCTGAAGAATCCAGCAGGATGGAGAAGAAGGCGTCCATCCTCATGAACCGG
TATGAGCTCGGCCGCATGCTCGGGCAAGGCACCTTCGCCAAGGTGTACCATGCACGGAAC
CTTGCATCCAACCAGAGCGTCGCCATCAAGGTCATTGACAAGGAAAAGGTATTGCGTGTC
GGCATGATTGACCAGATCAAGCGAGAGATCTCCATCATGCGCCTCGTTCGCCACCCCAAC
ATCGTCCAGCTGCACGAGGTCATGGCCAGCAAGAGCAAGATATACTTTGCAATGGAGTAT
GTCCGGGGTGGTGAGCTCTTCAGCAGGGTAGCCAGGGGGCGACTCAAGGAGGATGCTGCG
AGGAAGTACTTCCAGCAGTTGATAGGGGCTGTGGACTTCTGTCACAGCCGCGGTGTCTAC
CACCGAGACCTCAAGCCAGAGAACCTCCTCGTCGACGAGAATGGCAACCTCAAAGTGTCG
GACTTTGGGCTGAGCGCCTTCAAGGAGTGTCAGAAGCAGGACGGGCTGCTCCACACGACG
TGTGGCACACCTGCATATGTTGCACCAGAGATAATCAATAAGAGGGGCTATGATGGAGCA
AAAGCAGACATATGGTCTTGCGGTGTCATACTCTTTGTTCTGCTTGCTGGCTACCTCCCA
TTCCATGACTCAAATCTAATGGAGATGTACCGGAAGATAAGCAAAGGTGATGTCAAGTTC
CCACAGTGGTTCACTACTGATGTCCGAAGGCTTCTGTCCAGGCTGCTTGATCCAAATCCA
AACATTAGGATCACCGTTGAGAAGCTAGTTGAGCATCCATGGTTCAAGAAGGGGTACAAA
CCAGCAGTGATGCTATCACAGCCAAATGAATCAAACAACCTCAAGGATGTCCATACTGCT
TTCAGTGCTGATCACAAGGACAATGAAGGCAAGGCAAAAGAACCAGCAAGCTCTTTGAAG
CCAGTGAGCTTGAATGCATTTGACATCATCTCCCTCTCCAAAGGATTTGATCTGTCAGGC
CTGTTTGAGAACGACAAAGAGCAGAAGGCAGACTCACGGTTCATGACACAAAAACCAGCA
TCAGCAATAGTGTCAAAGCTAGAGCAGATTGCTGAGACAGAGAGCTTCAAGGTGAAGAAG
CAGGATGGACTGGTGAAGCTCCAGGGATCCAAAGAAGGGAGGAAAGGGCAGCTCGCGATC
GATGCAGAGATCTTTGAAGTGACACCATCCTTCTTTGTTGTTGAGGTGAAGAAGTCTGCA
GGGGACACGTTGGAGTACGAAAAATTCTGCAACAAGGGCCTAAGACCTTCTCTCAGGGAC
ATCTGCTGGGATGGTCAGTCAGAGCATCCATCACTGGCACAGTCATCAACTCTGACTCAG
TCCTCTAAGTCAATCTCGAGACATGCCATTTAAGTGCAACCTCATAAGAGATGCAGTAAC
AATCCATTTTCCTCTCTCCTTTTCCCTTTCATCAAAGTGCTGAGCCTGAGAGTATTCTCA
CTTGAGCATCAGGCTTAGGGCTCTTTGATGATAATTTTTGCCAGTTTTCCTTGTATAGTA
GCAGTTTGTCTACATGGATCTCCTGTTCTTTCACCAATAGAAACAGGGAGATTGACAACA
GC

CDS

1386 bp

>Os01t0206700-01 Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).
ATGGAGAAGAAGGCGTCCATCCTCATGAACCGGTATGAGCTCGGCCGCATGCTCGGGCAA
GGCACCTTCGCCAAGGTGTACCATGCACGGAACCTTGCATCCAACCAGAGCGTCGCCATC
AAGGTCATTGACAAGGAAAAGGTATTGCGTGTCGGCATGATTGACCAGATCAAGCGAGAG
ATCTCCATCATGCGCCTCGTTCGCCACCCCAACATCGTCCAGCTGCACGAGGTCATGGCC
AGCAAGAGCAAGATATACTTTGCAATGGAGTATGTCCGGGGTGGTGAGCTCTTCAGCAGG
GTAGCCAGGGGGCGACTCAAGGAGGATGCTGCGAGGAAGTACTTCCAGCAGTTGATAGGG
GCTGTGGACTTCTGTCACAGCCGCGGTGTCTACCACCGAGACCTCAAGCCAGAGAACCTC
CTCGTCGACGAGAATGGCAACCTCAAAGTGTCGGACTTTGGGCTGAGCGCCTTCAAGGAG
TGTCAGAAGCAGGACGGGCTGCTCCACACGACGTGTGGCACACCTGCATATGTTGCACCA
GAGATAATCAATAAGAGGGGCTATGATGGAGCAAAAGCAGACATATGGTCTTGCGGTGTC
ATACTCTTTGTTCTGCTTGCTGGCTACCTCCCATTCCATGACTCAAATCTAATGGAGATG
TACCGGAAGATAAGCAAAGGTGATGTCAAGTTCCCACAGTGGTTCACTACTGATGTCCGA
AGGCTTCTGTCCAGGCTGCTTGATCCAAATCCAAACATTAGGATCACCGTTGAGAAGCTA
GTTGAGCATCCATGGTTCAAGAAGGGGTACAAACCAGCAGTGATGCTATCACAGCCAAAT
GAATCAAACAACCTCAAGGATGTCCATACTGCTTTCAGTGCTGATCACAAGGACAATGAA
GGCAAGGCAAAAGAACCAGCAAGCTCTTTGAAGCCAGTGAGCTTGAATGCATTTGACATC
ATCTCCCTCTCCAAAGGATTTGATCTGTCAGGCCTGTTTGAGAACGACAAAGAGCAGAAG
GCAGACTCACGGTTCATGACACAAAAACCAGCATCAGCAATAGTGTCAAAGCTAGAGCAG
ATTGCTGAGACAGAGAGCTTCAAGGTGAAGAAGCAGGATGGACTGGTGAAGCTCCAGGGA
TCCAAAGAAGGGAGGAAAGGGCAGCTCGCGATCGATGCAGAGATCTTTGAAGTGACACCA
TCCTTCTTTGTTGTTGAGGTGAAGAAGTCTGCAGGGGACACGTTGGAGTACGAAAAATTC
TGCAACAAGGGCCTAAGACCTTCTCTCAGGGACATCTGCTGGGATGGTCAGTCAGAGCAT
CCATCACTGGCACAGTCATCAACTCTGACTCAGTCCTCTAAGTCAATCTCGAGACATGCC
ATTTAA

Protein

461 aa

>Os01t0206700-01 Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).
MEKKASILMNRYELGRMLGQGTFAKVYHARNLASNQSVAIKVIDKEKVLRVGMIDQIKRE
ISIMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGELFSRVARGRLKEDAARKYFQQLIG
AVDFCHSRGVYHRDLKPENLLVDENGNLKVSDFGLSAFKECQKQDGLLHTTCGTPAYVAP
EIINKRGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISKGDVKFPQWFTTDVR
RLLSRLLDPNPNIRITVEKLVEHPWFKKGYKPAVMLSQPNESNNLKDVHTAFSADHKDNE
GKAKEPASSLKPVSLNAFDIISLSKGFDLSGLFENDKEQKADSRFMTQKPASAIVSKLEQ
IAETESFKVKKQDGLVKLQGSKEGRKGQLAIDAEIFEVTPSFFVVEVKKSAGDTLEYEKF
CNKGLRPSLRDICWDGQSEHPSLAQSSTLTQSSKSISRHAI*

5'UTR

chr01:5811184..5811510 (- strand) : 327 bp

CDS

chr01:5809798..5811183 (- strand) : 1386 bp

3'UTR

chr01:5809589..5809797 (- strand) : 209 bp

FASTA

>Os01t0206700-01 class=Sequence position=chr01:5809589..5811510 (- strand)
ACAAACACCT GGCCTATTTT TAGGCATCCT CTTCCATCTC CAGAGAAGTG AGCCCCAGCC TCATGTCACA AGGGAAGCAC
TAGCCACCAT AGAACTCTCT CTCTTTTTCT CCTTCCTCCT AGGAGGATCC CAAATACACC AATCGTGTCT TGGATTTTCC
CAAACACAGC GCGCACTCTC GCCCTTCACC TCTCCTCCCT CTCACCCTTC CATTACATGG ATCAGGGAGG GAGGAAGGAG
GCCTGAAGTG GCGCAGAGTA GGCGCTTGTA AACAAATCCC CCCATTTGCT TCTTTTGCAC TGAAGAATCC CTGAAGAATC
CAGCAGGATG GAGAAGAAGG CGTCCATCCT CATGAACCGG TATGAGCTCG GCCGCATGCT CGGGCAAGGC ACCTTCGCCA
AGGTGTACCA TGCACGGAAC CTTGCATCCA ACCAGAGCGT CGCCATCAAG GTCATTGACA AGGAAAAGGT ATTGCGTGTC
GGCATGATTG ACCAGATCAA GCGAGAGATC TCCATCATGC GCCTCGTTCG CCACCCCAAC ATCGTCCAGC TGCACGAGGT
CATGGCCAGC AAGAGCAAGA TATACTTTGC AATGGAGTAT GTCCGGGGTG GTGAGCTCTT CAGCAGGGTA GCCAGGGGGC
GACTCAAGGA GGATGCTGCG AGGAAGTACT TCCAGCAGTT GATAGGGGCT GTGGACTTCT GTCACAGCCG CGGTGTCTAC
CACCGAGACC TCAAGCCAGA GAACCTCCTC GTCGACGAGA ATGGCAACCT CAAAGTGTCG GACTTTGGGC TGAGCGCCTT
CAAGGAGTGT CAGAAGCAGG ACGGGCTGCT CCACACGACG TGTGGCACAC CTGCATATGT TGCACCAGAG ATAATCAATA
AGAGGGGCTA TGATGGAGCA AAAGCAGACA TATGGTCTTG CGGTGTCATA CTCTTTGTTC TGCTTGCTGG CTACCTCCCA
TTCCATGACT CAAATCTAAT GGAGATGTAC CGGAAGATAA GCAAAGGTGA TGTCAAGTTC CCACAGTGGT TCACTACTGA
TGTCCGAAGG CTTCTGTCCA GGCTGCTTGA TCCAAATCCA AACATTAGGA TCACCGTTGA GAAGCTAGTT GAGCATCCAT
GGTTCAAGAA GGGGTACAAA CCAGCAGTGA TGCTATCACA GCCAAATGAA TCAAACAACC TCAAGGATGT CCATACTGCT
TTCAGTGCTG ATCACAAGGA CAATGAAGGC AAGGCAAAAG AACCAGCAAG CTCTTTGAAG CCAGTGAGCT TGAATGCATT
TGACATCATC TCCCTCTCCA AAGGATTTGA TCTGTCAGGC CTGTTTGAGA ACGACAAAGA GCAGAAGGCA GACTCACGGT
TCATGACACA AAAACCAGCA TCAGCAATAG TGTCAAAGCT AGAGCAGATT GCTGAGACAG AGAGCTTCAA GGTGAAGAAG
CAGGATGGAC TGGTGAAGCT CCAGGGATCC AAAGAAGGGA GGAAAGGGCA GCTCGCGATC GATGCAGAGA TCTTTGAAGT
GACACCATCC TTCTTTGTTG TTGAGGTGAA GAAGTCTGCA GGGGACACGT TGGAGTACGA AAAATTCTGC AACAAGGGCC
TAAGACCTTC TCTCAGGGAC ATCTGCTGGG ATGGTCAGTC AGAGCATCCA TCACTGGCAC AGTCATCAAC TCTGACTCAG
TCCTCTAAGT CAATCTCGAG ACATGCCATT TAAGTGCAAC CTCATAAGAG ATGCAGTAAC AATCCATTTT CCTCTCTCCT
TTTCCCTTTC ATCAAAGTGC TGAGCCTGAG AGTATTCTCA CTTGAGCATC AGGCTTAGGG CTCTTTGATG ATAATTTTTG
CCAGTTTTCC TTGTATAGTA GCAGTTTGTC TACATGGATC TCCTGTTCTT TCACCAATAG AAACAGGGAG ATTGACAACA
GC

Locus: Os01g0206700

Loading...

Locus: Os01g0206700

Loading...