Os01t0206700-02

Locus

Os01g0206700

Description

Similar to cDNA clone:J013031K24, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK05

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 5

Oryzabase Gene Symbol Synonym(s)

OsCIPK05, CIPK5, OsCIPK5, OsSTA7, OsSnRK3.2, SnRK3.2

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 5, Sucrose nonfermenting-1-related protein kinase 3.2

Transcript Evidence

AK069681 (DDBJ, Best hit)

Protein Evidence

B3GLZ8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

NAF domain (IPR004041)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

NAF/FISL domain (IPR018451)

Full-length cDNA

J023034N02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0206700-02)

RiceXPro (AK069681)

Others

Oryzabase (7392)

KEGG (Os01t0206700-02)

Transcript

1061 bp

>Os01t0206700-02 Similar to cDNA clone:J013031K24, full insert sequence.
TATGTTGCACCAGAGATAATCAATAAGAGGGGCTATGATGGAGCAAAAGCAGACATATGG
TCTTGCGGTGTCATACTCTTTGTTCTGCTTGCTGGCTACCTCCCATTCCATGACTCAAAT
CTAATGGAGATGTACCGGAAGATAAGCAAAGGTGATGTCAAGTTCCCACAGTGGTTCACT
ACTGATGTCCGAAGGCTTCTGTCCAGGCTGCTTGATCCAAATCCAAACATTAGGATCACC
GTTGAGAAGCTAGTTGAGCATCCATGGTTCAAGAAGGGGTACAAACCAGCAGTGATGCTA
TCACAGCCAAATGAATCAAACAACCTCAAGGATGTCCATACTGCTTTCAGTGCTGATCAC
AAGGACAATGAAGGCAAGGCAAAAGAACCAGCAAGCTCTTTGAAGCCAGTGAGCTTGAAT
GCATTTGACATCATCTCCCTCTCCAAAGGATTTGATCTGTCAGGCCTGTTTGAGAACGAC
AAAGAGCAGAAGGCAGACTCACGGTTCATGACACAAAAACCAGCATCAGCAATAGTGTCA
AAGCTAGAGCAGATTGCTGAGACAGAGAGCTTCAAGGTGAAGAAGCAGGATGGACTGGTG
AAGCTCCAGGGATCCAAAGAAGGGAGGAAAGGGCAGCTCGCGATCGATGCAGAGATCTTT
GAAGTGACACCATCCTTCTTTGTTGTTGAGGTGAAGAAGTCTGCAGGGGACACGTTGGAG
TACGAAAAATTCTGCAACAAGGGCCTAAGACCTTCTCTCAGGGACATCTGCTGGGATGGT
CAGTCAGAGCATCCATCACTGGCACAGTCATCAACTCTGACTCAGTCCTCTAAGTCAATC
TCGAGACATGCCATTTAAGTGCAACCTCATAAGAGATGCAGTAACAATCCATTTTCCTCT
CTCCTTTTCCCTTTCATCAAAGTGCTGAGCCTGAGAGTATTCTCACTTGAGCATCAGGCT
TAGGGCTCTTTGATGATAATTTTTGCCAGTTTTCCTTGTATAGTAGCAGTTTGTCTACAT
GGATCTCCTGTTCTTTCACCAATAGAAACAGGGAGATTGAC

CDS

858 bp

>Os01t0206700-02 Similar to cDNA clone:J013031K24, full insert sequence.
TATGTTGCACCAGAGATAATCAATAAGAGGGGCTATGATGGAGCAAAAGCAGACATATGG
TCTTGCGGTGTCATACTCTTTGTTCTGCTTGCTGGCTACCTCCCATTCCATGACTCAAAT
CTAATGGAGATGTACCGGAAGATAAGCAAAGGTGATGTCAAGTTCCCACAGTGGTTCACT
ACTGATGTCCGAAGGCTTCTGTCCAGGCTGCTTGATCCAAATCCAAACATTAGGATCACC
GTTGAGAAGCTAGTTGAGCATCCATGGTTCAAGAAGGGGTACAAACCAGCAGTGATGCTA
TCACAGCCAAATGAATCAAACAACCTCAAGGATGTCCATACTGCTTTCAGTGCTGATCAC
AAGGACAATGAAGGCAAGGCAAAAGAACCAGCAAGCTCTTTGAAGCCAGTGAGCTTGAAT
GCATTTGACATCATCTCCCTCTCCAAAGGATTTGATCTGTCAGGCCTGTTTGAGAACGAC
AAAGAGCAGAAGGCAGACTCACGGTTCATGACACAAAAACCAGCATCAGCAATAGTGTCA
AAGCTAGAGCAGATTGCTGAGACAGAGAGCTTCAAGGTGAAGAAGCAGGATGGACTGGTG
AAGCTCCAGGGATCCAAAGAAGGGAGGAAAGGGCAGCTCGCGATCGATGCAGAGATCTTT
GAAGTGACACCATCCTTCTTTGTTGTTGAGGTGAAGAAGTCTGCAGGGGACACGTTGGAG
TACGAAAAATTCTGCAACAAGGGCCTAAGACCTTCTCTCAGGGACATCTGCTGGGATGGT
CAGTCAGAGCATCCATCACTGGCACAGTCATCAACTCTGACTCAGTCCTCTAAGTCAATC
TCGAGACATGCCATTTAA

Protein

285 aa

>Os01t0206700-02 Similar to cDNA clone:J013031K24, full insert sequence.
YVAPEIINKRGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISKGDVKFPQWFT
TDVRRLLSRLLDPNPNIRITVEKLVEHPWFKKGYKPAVMLSQPNESNNLKDVHTAFSADH
KDNEGKAKEPASSLKPVSLNAFDIISLSKGFDLSGLFENDKEQKADSRFMTQKPASAIVS
KLEQIAETESFKVKKQDGLVKLQGSKEGRKGQLAIDAEIFEVTPSFFVVEVKKSAGDTLE
YEKFCNKGLRPSLRDICWDGQSEHPSLAQSSTLTQSSKSISRHAI*

CDS

chr01:5809798..5810655 (- strand) : 858 bp

3'UTR

chr01:5809595..5809797 (- strand) : 203 bp

FASTA

>Os01t0206700-02 class=Sequence position=chr01:5809595..5810655 (- strand)
TATGTTGCAC CAGAGATAAT CAATAAGAGG GGCTATGATG GAGCAAAAGC AGACATATGG TCTTGCGGTG TCATACTCTT
TGTTCTGCTT GCTGGCTACC TCCCATTCCA TGACTCAAAT CTAATGGAGA TGTACCGGAA GATAAGCAAA GGTGATGTCA
AGTTCCCACA GTGGTTCACT ACTGATGTCC GAAGGCTTCT GTCCAGGCTG CTTGATCCAA ATCCAAACAT TAGGATCACC
GTTGAGAAGC TAGTTGAGCA TCCATGGTTC AAGAAGGGGT ACAAACCAGC AGTGATGCTA TCACAGCCAA ATGAATCAAA
CAACCTCAAG GATGTCCATA CTGCTTTCAG TGCTGATCAC AAGGACAATG AAGGCAAGGC AAAAGAACCA GCAAGCTCTT
TGAAGCCAGT GAGCTTGAAT GCATTTGACA TCATCTCCCT CTCCAAAGGA TTTGATCTGT CAGGCCTGTT TGAGAACGAC
AAAGAGCAGA AGGCAGACTC ACGGTTCATG ACACAAAAAC CAGCATCAGC AATAGTGTCA AAGCTAGAGC AGATTGCTGA
GACAGAGAGC TTCAAGGTGA AGAAGCAGGA TGGACTGGTG AAGCTCCAGG GATCCAAAGA AGGGAGGAAA GGGCAGCTCG
CGATCGATGC AGAGATCTTT GAAGTGACAC CATCCTTCTT TGTTGTTGAG GTGAAGAAGT CTGCAGGGGA CACGTTGGAG
TACGAAAAAT TCTGCAACAA GGGCCTAAGA CCTTCTCTCA GGGACATCTG CTGGGATGGT CAGTCAGAGC ATCCATCACT
GGCACAGTCA TCAACTCTGA CTCAGTCCTC TAAGTCAATC TCGAGACATG CCATTTAAGT GCAACCTCAT AAGAGATGCA
GTAACAATCC ATTTTCCTCT CTCCTTTTCC CTTTCATCAA AGTGCTGAGC CTGAGAGTAT TCTCACTTGA GCATCAGGCT
TAGGGCTCTT TGATGATAAT TTTTGCCAGT TTTCCTTGTA TAGTAGCAGT TTGTCTACAT GGATCTCCTG TTCTTTCACC
AATAGAAACA GGGAGATTGA C

Locus: Os01g0206700

Loading...

Locus: Os01g0206700

Loading...