Os01t0206700-03

Locus

Os01g0206700

Description

Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK05

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 5

Oryzabase Gene Symbol Synonym(s)

OsCIPK05, CIPK5, OsCIPK5, OsSTA7, OsSnRK3.2, SnRK3.2

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 5, Sucrose nonfermenting-1-related protein kinase 3.2

Transcript Evidence

AK071552 (DDBJ, Best hit)

Protein Evidence

B3GLZ8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

NAF/FISL domain (IPR018451)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J023105C14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0206700-03)

Others

Oryzabase (7392)

Transcript

1801 bp

>Os01t0206700-03 Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).
GGAGGATCCCAAATACACCAATCGTGTCTTGGATTTTCCCAAACACAGCGCGCACTCTCG
CCCTTCACCTCTCCTCCCTCTCACCCTTCCATTACATGGATCAGGGAGGGAGGAAGGAGG
CCTGAAGTGGCGCAGAGTAGGCGCTTGTAAACAAATCCCCCCATTTGCTTCTTTTGCACT
GAAGAATCCCTGAAGAATCCAGCAGGATGGAGAAGAAGGCGTCCATCCTCATGAACCGGT
ATGAGCTCGGCCGCATGCTCGGGCAAGGCACCTTCGCCAAGGTGTACCATGCACGGAACC
TTGCATCCAACCAGAGCGTCGCCATCAAGGTCATTGACAAGGAAAAGGTATTGCGTGTCG
GCATGATTGACCAGATCAAGCGAGAGATCTCCATCATGCGCCTCGTTCGCCACCCCAACA
TCGTCCAGCTGCACGAGGTCATGGCCAGCAAGAGCAAGATATACTTTGCAATGGAGTATG
TCCGGGGTGGTGAGCTCTTCAGCAGGGTAGCCAGGGGGCGACTCAAGGAGGATGCTGCGA
GGAAGTACTTCCAGCAGTTGATAGGGGCTGTGGACTTCTGTCACAGCCGCGGTGTCTACC
ACCGAGACCTCAAGCCAGAGAACCTCCTCGTCGACGAGAATGGCAACCTCAAAGTGTCGG
ACTTTGGGCTGAGCGCCTTCAAGGAGTGTCAGAAGCAGGACGGGCTGCTCCACACGACGT
GTGGCACACCTGCATATGTTGCACCAGAGATAATCAATAAGAGGGGCTATGATGGAGCAA
AAGCAGACATATGGTCTTGCGGTGTCATACTCTTTGTTCTGCTTGCTGGCTACCTCCCAT
TCCATGACTCAAATCTAATGGAGATGTACCGGAAGATAAGCAAAGGTGATGTCAAGTTCC
CACAGTGGTTCACTACTGATGTCCGAAGGCTTCTGTCCAGGCTGCTTGATCCAAATCCAA
ACATTAGGATCACCGTTGAGAAGCTAGTTGAGCATCCATGGTTCAAGAAGGGGTACAAAC
CAGCAGTGATGCTATCACAGCCAAATGAATCAAACAACCTCAAGGATGTCCATACTGCTT
TCAGTGCTGATCACAAGGACAATGAAGGCAAGGCAAAAGAACCAGCAAGCTCTTTGAAGC
CAGTGAGCTTGAATGCATTTGACATCATCTCCCTCTCCAAAGGATTTGATCTGTCAGGCC
TGTTTGAGAACGACAAAGAGCAGAAGGCAGACTCACGGTTCATGACACAAAAACCAGCAT
CAGCAATAGTGTCAAAGCTAGAGCAGATTGCTGAGACAGAGAGCTTCAAGGTGAAGAAGC
AGGATGGACTGGTGAAGCTCCAGGGATCCAAAGAAGGGAGGAAAGGGCAGCTCGCGATCG
ATGCAGAGATCTTTGAAGTGACACCATCCTTCTTTGTTGTTGAGGTGAAGAAGTCTGCAG
GGGACACGTTGGAGTACGAAAAATTCTGCAACAAGGGCCTAAGACCTTCTCTCAGGGACA
TCTGCTGGGATGGTCAGTCAGAGCATCCATCACTGGCACAGTCATCAACTCTGACTCAGT
CCTCTAAGTCAATCTCGAGACATGCCATTTAAGTGCAACCTCATAAGAGATGCAGTAACA
ATCCATTTTCCTCTCTCCTTTTCCCTTTCATCAAAGTGCTGAGCCTGAGAGTATTCTCAC
TTGAGCATCAGGCTTAGGGCTCTTTGATGATAATTTTTGCCAGTTTTCCTTGTATAGTAG
CAGTTTGTCTACATGGATCTCCTGTTCTTTCACCAATAGAAACAGGGAGATTGACAACAG
C

CDS

1386 bp

>Os01t0206700-03 Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).
ATGGAGAAGAAGGCGTCCATCCTCATGAACCGGTATGAGCTCGGCCGCATGCTCGGGCAA
GGCACCTTCGCCAAGGTGTACCATGCACGGAACCTTGCATCCAACCAGAGCGTCGCCATC
AAGGTCATTGACAAGGAAAAGGTATTGCGTGTCGGCATGATTGACCAGATCAAGCGAGAG
ATCTCCATCATGCGCCTCGTTCGCCACCCCAACATCGTCCAGCTGCACGAGGTCATGGCC
AGCAAGAGCAAGATATACTTTGCAATGGAGTATGTCCGGGGTGGTGAGCTCTTCAGCAGG
GTAGCCAGGGGGCGACTCAAGGAGGATGCTGCGAGGAAGTACTTCCAGCAGTTGATAGGG
GCTGTGGACTTCTGTCACAGCCGCGGTGTCTACCACCGAGACCTCAAGCCAGAGAACCTC
CTCGTCGACGAGAATGGCAACCTCAAAGTGTCGGACTTTGGGCTGAGCGCCTTCAAGGAG
TGTCAGAAGCAGGACGGGCTGCTCCACACGACGTGTGGCACACCTGCATATGTTGCACCA
GAGATAATCAATAAGAGGGGCTATGATGGAGCAAAAGCAGACATATGGTCTTGCGGTGTC
ATACTCTTTGTTCTGCTTGCTGGCTACCTCCCATTCCATGACTCAAATCTAATGGAGATG
TACCGGAAGATAAGCAAAGGTGATGTCAAGTTCCCACAGTGGTTCACTACTGATGTCCGA
AGGCTTCTGTCCAGGCTGCTTGATCCAAATCCAAACATTAGGATCACCGTTGAGAAGCTA
GTTGAGCATCCATGGTTCAAGAAGGGGTACAAACCAGCAGTGATGCTATCACAGCCAAAT
GAATCAAACAACCTCAAGGATGTCCATACTGCTTTCAGTGCTGATCACAAGGACAATGAA
GGCAAGGCAAAAGAACCAGCAAGCTCTTTGAAGCCAGTGAGCTTGAATGCATTTGACATC
ATCTCCCTCTCCAAAGGATTTGATCTGTCAGGCCTGTTTGAGAACGACAAAGAGCAGAAG
GCAGACTCACGGTTCATGACACAAAAACCAGCATCAGCAATAGTGTCAAAGCTAGAGCAG
ATTGCTGAGACAGAGAGCTTCAAGGTGAAGAAGCAGGATGGACTGGTGAAGCTCCAGGGA
TCCAAAGAAGGGAGGAAAGGGCAGCTCGCGATCGATGCAGAGATCTTTGAAGTGACACCA
TCCTTCTTTGTTGTTGAGGTGAAGAAGTCTGCAGGGGACACGTTGGAGTACGAAAAATTC
TGCAACAAGGGCCTAAGACCTTCTCTCAGGGACATCTGCTGGGATGGTCAGTCAGAGCAT
CCATCACTGGCACAGTCATCAACTCTGACTCAGTCCTCTAAGTCAATCTCGAGACATGCC
ATTTAA

Protein

461 aa

>Os01t0206700-03 Similar to Serine/threonine protein kinase (CBL-interacting protein kinase 20).
MEKKASILMNRYELGRMLGQGTFAKVYHARNLASNQSVAIKVIDKEKVLRVGMIDQIKRE
ISIMRLVRHPNIVQLHEVMASKSKIYFAMEYVRGGELFSRVARGRLKEDAARKYFQQLIG
AVDFCHSRGVYHRDLKPENLLVDENGNLKVSDFGLSAFKECQKQDGLLHTTCGTPAYVAP
EIINKRGYDGAKADIWSCGVILFVLLAGYLPFHDSNLMEMYRKISKGDVKFPQWFTTDVR
RLLSRLLDPNPNIRITVEKLVEHPWFKKGYKPAVMLSQPNESNNLKDVHTAFSADHKDNE
GKAKEPASSLKPVSLNAFDIISLSKGFDLSGLFENDKEQKADSRFMTQKPASAIVSKLEQ
IAETESFKVKKQDGLVKLQGSKEGRKGQLAIDAEIFEVTPSFFVVEVKKSAGDTLEYEKF
CNKGLRPSLRDICWDGQSEHPSLAQSSTLTQSSKSISRHAI*

5'UTR

chr01:5811184..5811389 (- strand) : 206 bp

CDS

chr01:5809798..5811183 (- strand) : 1386 bp

3'UTR

chr01:5809589..5809797 (- strand) : 209 bp

FASTA

>Os01t0206700-03 class=Sequence position=chr01:5809589..5811389 (- strand)
GGAGGATCCC AAATACACCA ATCGTGTCTT GGATTTTCCC AAACACAGCG CGCACTCTCG CCCTTCACCT CTCCTCCCTC
TCACCCTTCC ATTACATGGA TCAGGGAGGG AGGAAGGAGG CCTGAAGTGG CGCAGAGTAG GCGCTTGTAA ACAAATCCCC
CCATTTGCTT CTTTTGCACT GAAGAATCCC TGAAGAATCC AGCAGGATGG AGAAGAAGGC GTCCATCCTC ATGAACCGGT
ATGAGCTCGG CCGCATGCTC GGGCAAGGCA CCTTCGCCAA GGTGTACCAT GCACGGAACC TTGCATCCAA CCAGAGCGTC
GCCATCAAGG TCATTGACAA GGAAAAGGTA TTGCGTGTCG GCATGATTGA CCAGATCAAG CGAGAGATCT CCATCATGCG
CCTCGTTCGC CACCCCAACA TCGTCCAGCT GCACGAGGTC ATGGCCAGCA AGAGCAAGAT ATACTTTGCA ATGGAGTATG
TCCGGGGTGG TGAGCTCTTC AGCAGGGTAG CCAGGGGGCG ACTCAAGGAG GATGCTGCGA GGAAGTACTT CCAGCAGTTG
ATAGGGGCTG TGGACTTCTG TCACAGCCGC GGTGTCTACC ACCGAGACCT CAAGCCAGAG AACCTCCTCG TCGACGAGAA
TGGCAACCTC AAAGTGTCGG ACTTTGGGCT GAGCGCCTTC AAGGAGTGTC AGAAGCAGGA CGGGCTGCTC CACACGACGT
GTGGCACACC TGCATATGTT GCACCAGAGA TAATCAATAA GAGGGGCTAT GATGGAGCAA AAGCAGACAT ATGGTCTTGC
GGTGTCATAC TCTTTGTTCT GCTTGCTGGC TACCTCCCAT TCCATGACTC AAATCTAATG GAGATGTACC GGAAGATAAG
CAAAGGTGAT GTCAAGTTCC CACAGTGGTT CACTACTGAT GTCCGAAGGC TTCTGTCCAG GCTGCTTGAT CCAAATCCAA
ACATTAGGAT CACCGTTGAG AAGCTAGTTG AGCATCCATG GTTCAAGAAG GGGTACAAAC CAGCAGTGAT GCTATCACAG
CCAAATGAAT CAAACAACCT CAAGGATGTC CATACTGCTT TCAGTGCTGA TCACAAGGAC AATGAAGGCA AGGCAAAAGA
ACCAGCAAGC TCTTTGAAGC CAGTGAGCTT GAATGCATTT GACATCATCT CCCTCTCCAA AGGATTTGAT CTGTCAGGCC
TGTTTGAGAA CGACAAAGAG CAGAAGGCAG ACTCACGGTT CATGACACAA AAACCAGCAT CAGCAATAGT GTCAAAGCTA
GAGCAGATTG CTGAGACAGA GAGCTTCAAG GTGAAGAAGC AGGATGGACT GGTGAAGCTC CAGGGATCCA AAGAAGGGAG
GAAAGGGCAG CTCGCGATCG ATGCAGAGAT CTTTGAAGTG ACACCATCCT TCTTTGTTGT TGAGGTGAAG AAGTCTGCAG
GGGACACGTT GGAGTACGAA AAATTCTGCA ACAAGGGCCT AAGACCTTCT CTCAGGGACA TCTGCTGGGA TGGTCAGTCA
GAGCATCCAT CACTGGCACA GTCATCAACT CTGACTCAGT CCTCTAAGTC AATCTCGAGA CATGCCATTT AAGTGCAACC
TCATAAGAGA TGCAGTAACA ATCCATTTTC CTCTCTCCTT TTCCCTTTCA TCAAAGTGCT GAGCCTGAGA GTATTCTCAC
TTGAGCATCA GGCTTAGGGC TCTTTGATGA TAATTTTTGC CAGTTTTCCT TGTATAGTAG CAGTTTGTCT ACATGGATCT
CCTGTTCTTT CACCAATAGA AACAGGGAGA TTGACAACAG C

Locus: Os01g0206700

Loading...

Locus: Os01g0206700

Loading...