Os01t0209700-01

Locus

Os01g0209700

Description

Similar to GA 2-oxidase 5.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GA2OX7

CGSNL Gene Name

GIBBERELLIN 2-OXIDASE 7

Oryzabase Gene Symbol Synonym(s)

OsGA2ox7

Oryzabase Gene Name Synonym(s)

GA 2-oxidase 7

Transcript Evidence

AK108802 (DDBJ, Best hit)

Protein Evidence

B3STR3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Oxoglutarate/iron-dependent oxygenase (IPR005123)

Full-length cDNA

002-151-C10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0209700-01)

RiceXPro (AK108802)

Others

Oryzabase (9083)

KEGG (Os01t0209700-01)

Transcript

1336 bp

>Os01t0209700-01 Similar to GA 2-oxidase 5.
ATCAAACTCAACCATCCTTGCTTTGGCTGCGTAGCGTGTAGCGCGCGCGAACGAACGAAC
ACACCAAGCTTTGCTCTGCTTTTCCTCTGTCCAAAACAGCCGGCCATGGTGGTGCTTGCC
AAGGGCGAGCTCGAGCAGATAGCCCTGCCGGCGGCGCACCCGCCGCCAGCCGACGTGCGC
GCGATCGACCTGTCCGCCACGGGTCCCGCCCGCGCGGCGGAGGCGCGCGCGCTGGTGGCG
GCGTGCGAGGAGCAGGGGTTCTTCCGGGTGACGGGCCACGGCGTGCCGCCGGGGCTGGTG
CGCGCCGCGGAGGCCGCCGCGGCGCGGTTCTTCGCGCTGCCGCAGCCCGACAAGGAGGCC
GCCGCAGGGGCGCCGCTCGGGTACGCCAGCAAGCGGATCGGCAGCGCCGGCGACCTCGGC
TGGATCGAGTACCTGCTACTCTGCCTCGCCCCCGCCGCCGCCGCCGCGGCATTGCCGTGC
GCCGCGACGTCGCCCACGCCTCCTTGCCCCTTACGGGAGCTTCTAcgcgagtacagcgcg
gcggtgcggcgggtggcgtgcggcgtgctggagctgatggcggaggggctcggcgtcggg
ccggcggacgcgctggcgcggctggtggcgcgcgagGACAGCGACTCCATCCTCAGGGTG
AACCACTACCCGCCGCGCCCCGATCAGCTGGGCGGCGGCGGCGGGCCGAACCTGACGGGG
TTCGGCGAGCACACCGACCCGCAGATCATCTCCGTGCTCCGCTCCAACGGCGCCCCCGGG
CTGGAGATCTCCCTCCGTGACGGCGCCTGGGCGTCCGTGCCGCACGACGGCGACGGCGAC
TCCTTTTTCGTCAACGTCGGCGACACCCTCCAGGTGCTAACGAACGGGAGGTTCAGGAGC
GTGAAGCACAGGGTGGTGGTGAACAGCGAGAAGTCGAGGGTGTCCATGGTCTTCTTCGGC
GGCCCGCCGCCCGGCGAGAGGCTGGCGCCGCTGCCGGCGTTATTAGGGGACGGCGGCCGG
AGCCGGTACAGGGAGTTCACCTGGAAGGAGTACAAGGGCAGCGGCTGCAAGGGCCGGCTC
GCCGACGACAGGCTCTGCAGATTTGAGAACTAGTAGTAGCAGTCATCTGACTTCTATGTA
CGTTTGTGTATATTAATTCGCAAGTAGTGATTATCACTGTGGTTTGCCTCTAGCAATAGC
CTTGTACGTAAATTTCAGTATGTGTTAATCTGTTTATATATAAGCTTCCAGCAAAAGTTG
CATGCATGTAAGTGCTCTGTGGACAGTTTAGTTTTATTACAATTAAATGAGCTCTCTTAA
GATGATGGTTGCTAGT

CDS

1008 bp

>Os01t0209700-01 Similar to GA 2-oxidase 5.
ATGGTGGTGCTTGCCAAGGGCGAGCTCGAGCAGATAGCCCTGCCGGCGGCGCACCCGCCG
CCAGCCGACGTGCGCGCGATCGACCTGTCCGCCACGGGTCCCGCCCGCGCGGCGGAGGCG
CGCGCGCTGGTGGCGGCGTGCGAGGAGCAGGGGTTCTTCCGGGTGACGGGCCACGGCGTG
CCGCCGGGGCTGGTGCGCGCCGCGGAGGCCGCCGCGGCGCGGTTCTTCGCGCTGCCGCAG
CCCGACAAGGAGGCCGCCGCAGGGGCGCCGCTCGGGTACGCCAGCAAGCGGATCGGCAGC
GCCGGCGACCTCGGCTGGATCGAGTACCTGCTACTCTGCCTCGCCCCCGCCGCCGCCGCC
GCGGCATTGCCGTGCGCCGCGACGTCGCCCACGCCTCCTTGCCCCTTACGGGAGCTTCTA
cgcgagtacagcgcggcggtgcggcgggtggcgtgcggcgtgctggagctgatggcggag
gggctcggcgtcgggccggcggacgcgctggcgcggctggtggcgcgcgagGACAGCGAC
TCCATCCTCAGGGTGAACCACTACCCGCCGCGCCCCGATCAGCTGGGCGGCGGCGGCGGG
CCGAACCTGACGGGGTTCGGCGAGCACACCGACCCGCAGATCATCTCCGTGCTCCGCTCC
AACGGCGCCCCCGGGCTGGAGATCTCCCTCCGTGACGGCGCCTGGGCGTCCGTGCCGCAC
GACGGCGACGGCGACTCCTTTTTCGTCAACGTCGGCGACACCCTCCAGGTGCTAACGAAC
GGGAGGTTCAGGAGCGTGAAGCACAGGGTGGTGGTGAACAGCGAGAAGTCGAGGGTGTCC
ATGGTCTTCTTCGGCGGCCCGCCGCCCGGCGAGAGGCTGGCGCCGCTGCCGGCGTTATTA
GGGGACGGCGGCCGGAGCCGGTACAGGGAGTTCACCTGGAAGGAGTACAAGGGCAGCGGC
TGCAAGGGCCGGCTCGCCGACGACAGGCTCTGCAGATTTGAGAACTAG

Protein

336 aa

>Os01t0209700-01 Similar to GA 2-oxidase 5.
MVVLAKGELEQIALPAAHPPPADVRAIDLSATGPARAAEARALVAACEEQGFFRVTGHGV
PPGLVRAAEAAAARFFALPQPDKEAAAGAPLGYASKRIGSAGDLGWIEYLLLCLAPAAAA
AALPCAATSPTPPCPLRELLREYSAAVRRVACGVLELMAEGLGVGPADALARLVAREDSD
SILRVNHYPPRPDQLGGGGGPNLTGFGEHTDPQIISVLRSNGAPGLEISLRDGAWASVPH
DGDGDSFFVNVGDTLQVLTNGRFRSVKHRVVVNSEKSRVSMVFFGGPPPGERLAPLPALL
GDGGRSRYREFTWKEYKGSGCKGRLADDRLCRFEN*

5'UTR

chr01:5972385..5972489 (- strand) : 105 bp

CDS

chr01:5971975..5972384 (- strand) : 410 bp

chr01:5969799..5970156 (- strand) : 358 bp

chr01:5969042..5969281 (- strand) : 240 bp

3'UTR

chr01:5968819..5969041 (- strand) : 223 bp

FASTA

>Os01t0209700-01 class=Sequence position=chr01:5968819..5972489 (- strand)
ATCAAACTCA ACCATCCTTG CTTTGGCTGC GTAGCGTGTA GCGCGCGCGA ACGAACGAAC ACACCAAGCT TTGCTCTGCT
TTTCCTCTGT CCAAAACAGC CGGCCATGGT GGTGCTTGCC AAGGGCGAGC TCGAGCAGAT AGCCCTGCCG GCGGCGCACC
CGCCGCCAGC CGACGTGCGC GCGATCGACC TGTCCGCCAC GGGTCCCGCC CGCGCGGCGG AGGCGCGCGC GCTGGTGGCG
GCGTGCGAGG AGCAGGGGTT CTTCCGGGTG ACGGGCCACG GCGTGCCGCC GGGGCTGGTG CGCGCCGCGG AGGCCGCCGC
GGCGCGGTTC TTCGCGCTGC CGCAGCCCGA CAAGGAGGCC GCCGCAGGGG CGCCGCTCGG GTACGCCAGC AAGCGGATCG
GCAGCGCCGG CGACCTCGGC TGGATCGAGT ACCTGCTACT CTGCCTCGCC CCCGCCGCCG CCGCCGCGGC ATTGCCGTGC
GCCGCGACGT CGCCCACGCC TCCTTGCCCC TTACGGTAAA TACCGATCTT TCCAAACGCA GCAGCAGCAG CGCCCTACTG
CTACTATCTC GCGGTGTTCT AGATTATATC TTTTAAGATT TGATGAAGTA TAATTATAAA CGTTTTATTA TCGATAAATA
CATCGTTTAT CATAAAAAAT TAATTAGTCA TAAATATGAG TATGCCACTG TAATAAATCT AAACGGTGAA TCGTATTTTG
GCACGCCACC ACGTGCGGGG TGCGTCGGAT TTTGACCGTT CCGGGAAGGA AGCGAGCGAA GGCACCAGGC GGCTGGACAA
AGCGGTGACA TCTACGTCTG CGTTGCGCGT TGCACCGGCG GGTTACTGTT GCTTCCGTGC CGCTGCCTGC GCAGACAGAT
ACATGCACCG TTGCTGCACG CATGTCACGT CTCTCCTCCG TTCCTTTGGG CATTATTAAG TCCAGTCATC GTTGAATCAT
CATTTTCTTC GCATCACTTT ATTTTCCTTT AACAAACTTT AATAATTGGT CCATTGGAAC GTTCGTGTCA AACAGTAGAT
GGAGGGTCCG ATCCTAGTGA GCTGAGCTCG GACAAGTGGA GTACTTGTTT CGACAGTACG GACACATGAT GTGTGCAACA
CAGGGTTTAT TGGGGTGTAG TGTAGGGACT GATCTGAAGT CGTTATACGC GCGCGCGAGC AGCAAAACGG AATCATGCTA
TTATTAGTTC CATTCCATTT TGCTGTGTAG TAGTATAAGC AAGCGATAGT TTTGTCCAGG AATCTTTCTG ATGTTCGCAT
GCACCAGCAT TGGATACCTT AGGACTTGCT GTTCTTCTTT TCCCCGTGTA TTTCCATTTG GCACGTGGAA CATTTTACTT
GAGTTGAAGT TCACAGGAAC GTCAGCAACA TTCTAAAAAG CTCATTAAGT GTGGTGTGTG GTGGAGCCAT GTCACCCATG
TGCGCATGAC TTCACTCATT ACCAGTGGTC TAAGAGGGTG TTTGGGAGAG ACTTATGCTT TTGTGAAAGG GACTTCCTAT
TTTCCAAACA CCCCTAAATT ATATTACCAA AAAATACACA CGTACGCATA TACTTAATTT ATCATTGGTT TTTATCTTTT
TAAGTCTTAG AGTGTAATAG TGTAGTGTTG TGTGATTGAG AAAAGATTCG GGATTCAAAT TCATGACGTG GGTATCGTTC
TCCATTAATT AATTCGAGTC ACGCATATGT TTTCAGACTT TCAGCATTAC TCTTTCCGTT CCATATAAAG TAAATCTAGA
ACCGAATATA ATACATTTTA ATACTATAAA TCTAGACATA TTTATATTTA GATTCGTCGT GGATGTATCA CCTCCAATCT
TAAGTTAATT CTTCTAGAGG GGCTTTTGAT ACATTCATAA ATAAGCGTTC ATTTATTGTA GTGTTGCCCA TCTGGTAAAT
TAATAGTGAG AAAATCGTGT GGATAAGATC GCCCATCGTG GCCGCGTGTC GCTTCACAAT ATCTCGGGGC CGACGTACGG
AGACCGGCGC CGGCGGCTCC GTCTGACGCT GCCGTTTTGA TTCACGTGCG CGCACGGTCG CATCGCCGTA CGTGGCGCAG
CTCGCCACAT CGGTCGCATG CATGGTGGTG ATCGACCAAC ACCACCGCCG GATCATGCAT GATGCATCTC CCCTGACCTG
CGGATCTGCC CGTCTCTATC CACAAACCTT TTACATCATC ACGATCCAAG CCGCCGATCG AATTCGTTGC GCGATTTTGG
CTTGATCTCT TTGTTGGTTT CTTCTTCAGT TGCGTTCTGC GTGAACCGCG ATCGGTGGTT TAGTCTGGTT TGTTTATTTT
GCTCGCGGTG CAGGGAGCTT CTAcgcgagt acagcgcggc ggtgcggcgg gtggcgtgcg gcgtgctgga gctgatggcg
gaggggctcg gcgtcgggcc ggcggacgcg ctggcgcggc tggtggcgcg cgagGACAGC GACTCCATCC TCAGGGTGAA
CCACTACCCG CCGCGCCCCG ATCAGCTGGG CGGCGGCGGC GGGCCGAACC TGACGGGGTT CGGCGAGCAC ACCGACCCGC
AGATCATCTC CGTGCTCCGC TCCAACGGCG CCCCCGGGCT GGAGATCTCC CTCCGTGACG GCGCCTGGGC GTCCGTGCCG
CACGACGGCG ACGGCGACTC CTTTTTCGTC AACGTCGGCG ACACCCTCCA GGTACGTAGT ACACGTACTA TACTTCCGTT
GCTTGCGTGC ACACACAAAA TTAAAGGTCA AAAAGTTTGG TCACTTCTGC TGTTTCGCGT ACGTGCCCCT GTCGATGTCG
AATCGACCGT TCCATCGATC TCCAATCCAG TCGAGCAAAT CAGGGTGATC AGTGCACGAT CGACTGCACG GTGTACTATG
CGTCAAGCAA GCGCCATCAA CGCACGGTTA CTTGTATGGT TAACTAGCAC AATCATCTGC ATGCCATGCA TATATAGGGC
CCAGCCTGCA CGTGAAAACA CGTACACTTG CATGCTAGTA CGTACGTGCC TACTACTACT ACTAATGGGT CCATGAACGG
TGATGAGATC GATCGGTCAC TGCAATTTGC CAACTCTCAA GAAAAGGCCA TGCAAATTGT TGCACATCAC ATCGATTAAT
TATTGACTTA ATTATTTACA TTTCTCTGTA TCCCTGAGGT TAAATTTCTT TGTGCTGCTC GTGTGTTTGC GCTTTGCAAC
CCACCCAGGT GCTAACGAAC GGGAGGTTCA GGAGCGTGAA GCACAGGGTG GTGGTGAACA GCGAGAAGTC GAGGGTGTCC
ATGGTCTTCT TCGGCGGCCC GCCGCCCGGC GAGAGGCTGG CGCCGCTGCC GGCGTTATTA GGGGACGGCG GCCGGAGCCG
GTACAGGGAG TTCACCTGGA AGGAGTACAA GGGCAGCGGC TGCAAGGGCC GGCTCGCCGA CGACAGGCTC TGCAGATTTG
AGAACTAGTA GTAGCAGTCA TCTGACTTCT ATGTACGTTT GTGTATATTA ATTCGCAAGT AGTGATTATC ACTGTGGTTT
GCCTCTAGCA ATAGCCTTGT ACGTAAATTT CAGTATGTGT TAATCTGTTT ATATATAAGC TTCCAGCAAA AGTTGCATGC
ATGTAAGTGC TCTGTGGACA GTTTAGTTTT ATTACAATTA AATGAGCTCT CTTAAGATGA TGGTTGCTAG T

Locus: Os01g0209700

Loading...

Locus: Os01g0209700

Loading...