Os01t0217500-01

Locus

Os01g0217500

Description

ThiJ/PfpI domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1A, DJ-1A

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein A, DJ-1 protein A

Transcript Evidence

AK063270 (DDBJ, Best hit)

Protein Evidence

B8AAK4 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

ThiJ/PfpI (IPR002818)

DJ-1 (IPR006287)

Full-length cDNA

001-113-B10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0217500-01)

RiceXPro (AK063270)

Others

Oryzabase (20912)

KEGG (Os01t0217500-01)

Transcript

1474 bp

>Os01t0217500-01 ThiJ/PfpI domain containing protein.
AGCTCGTTCAATGCGCCCGGTGTCTCCTCCTCCCAACTACACACCCCCGCAATCTCGCTC
GCTAGCTCGCTGATCGATCAAGCTCAAGCTCAAGCTAGCTTCGGTCGTCGGCAATGGCGG
CGCAGGCGTCTCCTCCAACGAAGAAGGTGTTGGTGCCGATCGTCGCCGGCACGGAGCCGG
TGGAGGCGGCGGTGCCCATCGACGTCCTCCGCCGCGCCGGCGCGGACGTCACCGTGGCTT
CCGCCGATGATGGCGAGCTGGTCGTCGAGGTCATGTACGGCGTCAGGATCGTCGCGGACG
CGCTCGTCGCCGGCGGCGACTGCGCCGCCGCTCACTTCGACCTCATCGTCCTCCCGGGAG
GGGTTCCAGGCGCGGCGAACCTCGGCGGCTGCGCGGCGCTGGAAGCCATGGTGAGGAGGC
ACGCGGCGACCGGAGGTCTCTACGCCGCCATCTGCGCCGCGCCGCCGCTGGCGCTGGCGT
CCTGGGGCATGCTCAACGGCCTCAAGGCAACTGCTCATCCGCTGTTCGTGGACAAGTTCC
CACCGGAGGTGGCCGCCGTGGATGCGAGCGTGGTGGTGGACGCGAGCGCCGTCACGAGCC
GTGGCCCGGCGACGTCGACGGAGTTCGCTCTCGCTCTGGTAGAGCAACTCTACAGCAAGA
ACAAGGCCGAGCAGATCGCAAAAGAAATGCTTGTCAGATACGATGCTGGGTATACCATCG
ATGAAGTCAACTCGGTTCAATGGAAATGTAACGGCACGCCCAAGGTCCTTGTTCCAGTAG
CCAATGGCACCGAGGAGATGGAGCTGATAACAATCATCGACGTCCTGCGCAGAGCCGACG
CGGACGTCGTCGTTGCGTCGGCGGAAAACGCCGGCGTCGAGATCGTCGCGCGCCACGGGA
TGAGGATCGTGGCTGACACGACGCTGGACGAGGCGGCTGCCGATGATCAGACGAGCAGCT
TCGACCTGATCATCCTACCGGGTGGCACGCCTGGCGCGAAGACGATGAGCAGCAACGAGA
AGCTTGTCACTCTACTGAAGAAGCAGGCGGCGGCGAGCAAGCCCTACGGCGCCATTGGCG
CCGCGACGGCTCATGTGCTCGAGCCCCACGGTCTGCTCGAGGGCAAGAAAGCGGCGGATC
AGGATGGCGGCGACGAGTGCGAGAGCAGAGTGGTGGTTGATGGGAACGTGATCACGAGCG
GAGGCACCGGCACCGCCATGGAGTTCGCCGTGGCCGCCGTCGAGAAGCTGCTCGGCCGCG
ACGTGGCGCAGAGGGTTGCGGAAGGCTTGCTTTTTGCCTGATCGATCTTCTGTTGGTTTT
AGGTGATCAAACCAATGAAAGTTTTCATAATGCAGATGTGTGATCTGTGAAAGAGATAAT
TTTCCTTCCAAGAAAAAGACATAAAGAGTTGTCATTTGTCAAACCATCAACATTTGTTCT
CCCATAAACTTATAAGGGTGTTTTCTTAATTTAT

CDS

1188 bp

>Os01t0217500-01 ThiJ/PfpI domain containing protein.
ATGGCGGCGCAGGCGTCTCCTCCAACGAAGAAGGTGTTGGTGCCGATCGTCGCCGGCACG
GAGCCGGTGGAGGCGGCGGTGCCCATCGACGTCCTCCGCCGCGCCGGCGCGGACGTCACC
GTGGCTTCCGCCGATGATGGCGAGCTGGTCGTCGAGGTCATGTACGGCGTCAGGATCGTC
GCGGACGCGCTCGTCGCCGGCGGCGACTGCGCCGCCGCTCACTTCGACCTCATCGTCCTC
CCGGGAGGGGTTCCAGGCGCGGCGAACCTCGGCGGCTGCGCGGCGCTGGAAGCCATGGTG
AGGAGGCACGCGGCGACCGGAGGTCTCTACGCCGCCATCTGCGCCGCGCCGCCGCTGGCG
CTGGCGTCCTGGGGCATGCTCAACGGCCTCAAGGCAACTGCTCATCCGCTGTTCGTGGAC
AAGTTCCCACCGGAGGTGGCCGCCGTGGATGCGAGCGTGGTGGTGGACGCGAGCGCCGTC
ACGAGCCGTGGCCCGGCGACGTCGACGGAGTTCGCTCTCGCTCTGGTAGAGCAACTCTAC
AGCAAGAACAAGGCCGAGCAGATCGCAAAAGAAATGCTTGTCAGATACGATGCTGGGTAT
ACCATCGATGAAGTCAACTCGGTTCAATGGAAATGTAACGGCACGCCCAAGGTCCTTGTT
CCAGTAGCCAATGGCACCGAGGAGATGGAGCTGATAACAATCATCGACGTCCTGCGCAGA
GCCGACGCGGACGTCGTCGTTGCGTCGGCGGAAAACGCCGGCGTCGAGATCGTCGCGCGC
CACGGGATGAGGATCGTGGCTGACACGACGCTGGACGAGGCGGCTGCCGATGATCAGACG
AGCAGCTTCGACCTGATCATCCTACCGGGTGGCACGCCTGGCGCGAAGACGATGAGCAGC
AACGAGAAGCTTGTCACTCTACTGAAGAAGCAGGCGGCGGCGAGCAAGCCCTACGGCGCC
ATTGGCGCCGCGACGGCTCATGTGCTCGAGCCCCACGGTCTGCTCGAGGGCAAGAAAGCG
GCGGATCAGGATGGCGGCGACGAGTGCGAGAGCAGAGTGGTGGTTGATGGGAACGTGATC
ACGAGCGGAGGCACCGGCACCGCCATGGAGTTCGCCGTGGCCGCCGTCGAGAAGCTGCTC
GGCCGCGACGTGGCGCAGAGGGTTGCGGAAGGCTTGCTTTTTGCCTGA

Protein

396 aa

>Os01t0217500-01 ThiJ/PfpI domain containing protein.
MAAQASPPTKKVLVPIVAGTEPVEAAVPIDVLRRAGADVTVASADDGELVVEVMYGVRIV
ADALVAGGDCAAAHFDLIVLPGGVPGAANLGGCAALEAMVRRHAATGGLYAAICAAPPLA
LASWGMLNGLKATAHPLFVDKFPPEVAAVDASVVVDASAVTSRGPATSTEFALALVEQLY
SKNKAEQIAKEMLVRYDAGYTIDEVNSVQWKCNGTPKVLVPVANGTEEMELITIIDVLRR
ADADVVVASAENAGVEIVARHGMRIVADTTLDEAAADDQTSSFDLIILPGGTPGAKTMSS
NEKLVTLLKKQAAASKPYGAIGAATAHVLEPHGLLEGKKAADQDGGDECESRVVVDGNVI
TSGGTGTAMEFAVAAVEKLLGRDVAQRVAEGLLFA*

5'UTR

chr01:6412786..6412898 (+ strand) : 113 bp

CDS

chr01:6412899..6412931 (+ strand) : 33 bp

chr01:6413001..6413210 (+ strand) : 210 bp

chr01:6413302..6413451 (+ strand) : 150 bp

chr01:6414787..6414969 (+ strand) : 183 bp

chr01:6418705..6418779 (+ strand) : 75 bp

chr01:6418959..6419173 (+ strand) : 215 bp

chr01:6419277..6419418 (+ strand) : 142 bp

chr01:6419515..6419694 (+ strand) : 180 bp

3'UTR

chr01:6419695..6419867 (+ strand) : 173 bp

FASTA

>Os01t0217500-01 class=Sequence position=chr01:6412786..6419867 (+ strand)
AGCTCGTTCA ATGCGCCCGG TGTCTCCTCC TCCCAACTAC ACACCCCCGC AATCTCGCTC GCTAGCTCGC TGATCGATCA
AGCTCAAGCT CAAGCTAGCT TCGGTCGTCG GCAATGGCGG CGCAGGCGTC TCCTCCAACG AAGAAGGTAA CATATGATGA
TTATAGTGTG TGCATGTTCG CGCGGAGTGT TTGATTCGAT CGTACGCGTG TGCAGGTGTT GGTGCCGATC GTCGCCGGCA
CGGAGCCGGT GGAGGCGGCG GTGCCCATCG ACGTCCTCCG CCGCGCCGGC GCGGACGTCA CCGTGGCTTC CGCCGATGAT
GGCGAGCTGG TCGTCGAGGT CATGTACGGC GTCAGGATCG TCGCGGACGC GCTCGTCGCC GGCGGCGACT GCGCCGCCGC
TCACTTCGAC CTCATCGTCC TCCCGGTACG TACAATATAT TGCGGCCAAT GGCGACACCG ATGGATGCGG CATGGAAGAA
GCTCATCTTG AATTCTGCGA GATATGCCGC GCGCAGGGAG GGGTTCCAGG CGCGGCGAAC CTCGGCGGCT GCGCGGCGCT
GGAAGCCATG GTGAGGAGGC ACGCGGCGAC CGGAGGTCTC TACGCCGCCA TCTGCGCCGC GCCGCCGCTG GCGCTGGCGT
CCTGGGGCAT GCTCAACGGC CTCAAGGTTG CTAAAGCTAG CAAGTGGTCA CTCCAGTCCA CTGCTCACTA TTGCTATTCT
CCACTATCAC AATTCACTGC TTAATTTCCA GCTGGTTTTT TTTTTCTAAA ATTAtactcc ctccatttta aaatgtttga
caccgttgac tttttagtac gtgtttgacc attcgtctta ttcaaaaaat ttaactaatt atttattctt ttcatatcat
tcgatttatt gttaaatata cttttatgta cacatatagt tttacatatt tcacaaaaaa aaatttgaat aagacgaacg
gtcaaacata tgttaaaaag tcaacggtgt caaacatttt gaaacggagg gagtaCATAG GTACTTGAGA TATACTCCAT
CCGTTTCAGG ATATAAGACG TTTTAACttt ggtcaaagtc aatctgcttt aagtttgatc aagtttgtag aaaaaagtag
tagcattttc aacctaagat aaatttatta tgaaaatata ttcaattatt gattcaatga aactaattta atattataaa
tagtattata tttatctata agcttagtta aatttaaaac agtttaactt tgatTAAAGT CAAAACGTCT TATAAACTGG
AACGGAGGGA TAAGTATTTA CCACAAAACA CATGTTTAAC AGACGACCTC AAAGAAACGA AGGGTGTCGG TAAATACCTA
ATCTCACTAA ATCATGTCCA TAATTTAAAA CACATGTGTA CGTTTTGACA TGGAGTATTT TTTAAGAAAC CGTATACTTA
CATAAAATAC TTCACCGATT GATTTACATG TATTCAATTA GATAAAAAAT GGTTATGGAA CCAAGTAACA AATTAATGTT
TGTTCAAAAG ATTAAAAATA CCACATAGTG GAACATTTTG CCATTATCTA GAAAAATAGA ACATTTTGCC ATAAAAGGAT
TCCTCAAAAT AAATTATAAT AAACGGTGTT TGCGTTTTCC TCATTTTATA TATGAAATTT ACTCTACAGA GAGAGAAGGC
ACCAAAACTG TGGTGCAAAA AGGTTTgggg catttgcaaa tttgccaccg gtttttaatt ttgcaacgat gccactcgaa
tgatagttct agtgatattt ttataatttt ttagtggcag tcttgcaata acgattcaaa acagtggtaa aacagtggta
agtttgcaat tgGCTCAAAG GTTTTAAAGT TGAGCTATGA TGGTGTACGC ACCTACACTC CCAGTAAGCT AATTTTGAAA
TACACAAAAT TAACCACAAA TCGTTAATTT ATTAATCATG ATTCATAACC GTCAAATATG ATATGTCTTT GCATGATGAA
GGCAACTGCT CATCCGCTGT TCGTGGACAA GTTCCCACCG GAGGTGGCCG CCGTGGATGC GAGCGTGGTG GTGGACGCGA
GCGCCGTCAC GAGCCGTGGC CCGGCGACGT CGACGGAGTT CGCTCTCGCT CTGGTAGAGC AACTCTACAG CAAGAACAAG
GCCGAGCAGA TCGCAAAAGA AATGGTAATT AATTATATAT ATGGTTCTAC TAACTTTGGC ACTTGATTAA TAGCTACCTA
ACTCCGTCTT AGAGTATAGC ACTTAAAGAT CGGATGTCTC ATCCAATTTT AAACTGTTAG ATTGCTATAT ATTCTAGCAC
GGAGGTAGTA AAATTTCTCT CATTGGATCT TACCCATTGT TACTCTTGTT GATTTTTTTT TACCATGGCA AGACCTGTCC
ATTAATTGTA AAGATTTTGA AAAATGTTTT TGTTTGAATT TTTATTTTTA AAGTAAGATT GGTTAGGCTG CTAGCtactt
ccttcatctt gcagtatcag gcttgtaagc atcttgatat tcaactttta aaattattga ccaacaataa tcagtctaat
aaaagtcaaa ttttatttga tgagaataat ataattggat tgacatttaa atcccctttc ctactatagt tgtagaatat
gataaactaa aagttaaaga ttagttttat aaaccaagct aaatttgacc gcgtattatt tggtgggaAA ATGGTGTGGT
ACCTCCTATT TTTAATATAT GATACTATTt tcttttttga aaaaaaattg accaacaata tttatttatt tagatctctg
atcaaaagta ctttgagcat ggctagtatg tttgcctatt tacataaata tttaaaagaa aataatagcc aaacgaatta
gAATAATCAT TTTAAAAGAC AGGTATTTTT AGTTTACTAT CAAATGGGTG CTAACATTTT CGACAAAGTT GTGTTTGGTA
TGTTACCTGA AGTAGTAAAC GACCATGGTC CATGGACTAT GCCAAACTTA ACTAAATTAC ATAATCTGGT AATCTATATA
TTTATATAAG CAAGTATATA TACTCTCTAT ATATAGGTGG ACCAAATAGA CTATAATTAA GCTTTTTTTT AAGAGTATAT
GGAGTACATC TGCCCATGTA CGTCTATATT CATTATTAGT TTTTTTTAGA AGAAATGAAC TCGAGAAATA TAGGATActc
ccttcttgta aaggaggtcg ttttggacag cgacacggtc tccaaaacat aattttgact tcttatttct ataaaaatat
ttattgacaa gtgatatata tgtatacttt tcaagacaaa tctattcata taatttttac attttcaaac ttaacaactt
aagagttatt catgatttat aCATCTGCCC ATGTACGTAT tgtcggagat atgggcccgg ggatatgcga agtgagggga
gtttaccttc ccatcctgtc gcgtgaccct acagcctggt cctacccccg caccccgcga atcgcaggag cggcccgagg
ggcctcgggg tgccacgtca tgccccttgg gccctcgcgt cgctttgccc cgaggccctc gcccggctgc catctagcgg
ggggagcaag cggggagggg gcccaggctg aaccgccttt aatgcgcaca acgccccaac tgccccttgc gggcagacgt
gcggcgtgcc cgactggcgt gcgtcagtca agaatgaccg gtccgtgacc agcctgtcgc cggtcacgtc tgactggacg
gacggccgtg cccccacgtc gcatctgtct ccggcagagt ggaggtaggt atgacccgtc ccatcggagg gtcattcgga
gctctctcca cgagagagcg gccaccacaa gtcttcaccc attaatgagg gaatgacagg gctgcccccc gtgtcaggcg
ggggacggcg ctggccccac tcaagaacga gctgtggctt agcttccagg cgaaggcacg agtcgagatc cggtcaaggt
agggtgggtc cccacccggt agaagagtag gtagaggcgg tgcatgtggt atccccttga gctataaaag gaggaccttg
cctaccgaga aaagggggac gactctcaga aaacctgggc tctaggagaa gaggaccgag aacgctctcc ggagtttagg
aacctttgta actcttaccc tgaatcccac acacaggagt agggtattac acttcatagc ggcccgaacc tgtataatct
tgtcgtgtac acgctgccta gcagccttca gggcggatac gtgatttcta gagacgagct ctttcccccg gccgaactca
caaaagggga tcccacgatc tcccgctaga gaggtttacA TGATTAGTTT TTTTAGAAGA AATGAACTCG AGAAATATAG
GATActccct tcgtacttgt aaaggaagtc gttttggaca gcgacacggt ctccaaaaca caattttgac ttcttgtttc
tataaaaata tttattgaca agtgatatat gtatactttt caagacaaat ctattcatat aatttttaca ttttcaaact
taacaactta agagttatta atgatttata tttccaaggt ttgacttaaa cattattcta aacaactttt tttacaagta
cggaaggagT AATTAGGACA CAGTTCCTCG TTTCCAGGAA TGGGTGGCAT AATTTATGAG GAAATGGACG GTACATTGCG
GCGGTCTAAT AATTGTCTAA CGTTGTATTG AATGTTCACT TCACATGTGC CGTTGTCAGC TCAAAATCGG TTGTGGAAAG
TCAGGGCAGG AATTTATTGT CTAGATAAGC CCCCATGGCC TCATGGTCAT ATGGGCCATA TGCCGATAGC TGTTGATACT
TGATAGTATG ATGGTGTGTG TTGACTGCTG CTATGGTCAT GGGGCCAAAT GTTTCTGAAA TGCAGTCAGA GAACTTCATG
AGCACTAGAA CGGAATATAC TGAAAATAAA TACTCCATAT TTTCCCACCT ACTCCATATA ATACTTATTG GGTTGAAATA
AAATTCTATA TGGTCATACT TGGATAATAT GTCATACTAA TTTGTATAGT ATTTGCGATT TCGTTGCTAA AAAAACCATA
GGCGATCCCT GATGTGCTCT CTTTTTTTAA AAAAAAATCA TTGCTAAAAT AAGTGTGGTT AAATTTTAAA TGTGAATATA
GTAGTTGGAT TATTTGAGAT CTTCTTTTTT TTTTAGAAAA TAGATTAAAA CCTGGCCTCT ATATCTAACA CAGATGTACG
CAGCTAAGGT GGATTATTTG TGAATGAAAC ATACATGACA AAGTTCTGCA ATTGCTCTCT TCAAACCCTA AACTCGTGCT
AATAGTTCAT TAAGAAATGt actcccccat cccaaaatat aagaatctag aaccggataa gacatttTTT TTATATTTTG
GGATGAAGAT AGTATACATT AATCTTAAAA GTAGTCAGTG TACCAAGCCA GTCTACTTGA TTTGACTATG ATAGGACTTT
TGGAGAGTGT AGTAGTACTT ATATAAGAGA AATTTTACGG TCGTTGAGAA GGTACCGATA GTGTAAATTT TCATAAATTA
ATTAACATTG GAAAATGTTA TTGTAATATA TTGTGGAGCA TTCTTTTAAA CAAAGAAAGT CCATAATACA AGTGTTGACA
AATAGGTGGA CCAGAAATTA ATCAACAAAG TTACCTTGTC CACGGTCCCA CCCATCAACT ACCTAGGACT AGGAAGCTGG
CATTTGTAAG CATGGCAGAT TTGAGCTCTG CTCCTTGACT CATCACTTTA TGAACAGCAA ATCATCCCCC CCCCCCCCCC
CCCGCTTTTG TTGTTTTTAC TGTCATAGCT TGATCAACAT ATGAGTTAAC TCCCTATATC TTGTGCCTCA AATTGTCAGC
TTGTCAGATA CGATGCTGGG TATACCATCG ATGAAGTCAA CTCGGTTCAA TGGAAATGTA ACGGCACGCC CAAGGTACAT
ATACAAGAGA TGAAACCTAA ACACTTATCT TAACACTAGC TAGCATTTCA TACCTCATAA GTGATCGATG GAGCTCTTCC
AAATCACCAT GGAGAGAAAA AAAAAAGGAT AGCATTTCTT ATACAATATA AAAGCCAGAA CTTCTCTGAA AATTTGCCTC
TGTTTTGTGT CAGGTCCTTG TTCCAGTAGC CAATGGCACC GAGGAGATGG AGCTGATAAC AATCATCGAC GTCCTGCGCA
GAGCCGACGC GGACGTCGTC GTTGCGTCGG CGGAAAACGC CGGCGTCGAG ATCGTCGCGC GCCACGGGAT GAGGATCGTG
GCTGACACGA CGCTGGACGA GGCGGCTGCC GATGATCAGA CGAGCAGCTT CGACCTGATC ATCCTACCGG CAAGCAGCAT
ACACGAACTC TCGCTGTCCA AACCCATTTT GATCTGAACA TGTTCAGATC ACTGAACGTC TGAACACTTT CTCTCCTCGT
CTCAAACAAC AGGGTGGCAC GCCTGGCGCG AAGACGATGA GCAGCAACGA GAAGCTTGTC ACTCTACTGA AGAAGCAGGC
GGCGGCGAGC AAGCCCTACG GCGCCATTGG CGCCGCGACG GCTCATGTGC TCGAGCCCCA CGGTCTGCTC GAGGTAAATT
AAAGAACATT AGACAAGATC GCTTGCTTTT GATCAGTGAT ATTCTGTCGA GACCTGACAC ACATCGAGCG GCCGCGCGAT
TGATTTCAGG GCAAGAAAGC GGCGGATCAG GATGGCGGCG ACGAGTGCGA GAGCAGAGTG GTGGTTGATG GGAACGTGAT
CACGAGCGGA GGCACCGGCA CCGCCATGGA GTTCGCCGTG GCCGCCGTCG AGAAGCTGCT CGGCCGCGAC GTGGCGCAGA
GGGTTGCGGA AGGCTTGCTT TTTGCCTGAT CGATCTTCTG TTGGTTTTAG GTGATCAAAC CAATGAAAGT TTTCATAATG
CAGATGTGTG ATCTGTGAAA GAGATAATTT TCCTTCCAAG AAAAAGACAT AAAGAGTTGT CATTTGTCAA ACCATCAACA
TTTGTTCTCC CATAAACTTA TAAGGGTGTT TTCTTAATTT AT

Locus: Os01g0217500

Loading...

Locus: Os01g0217500

Loading...