Os01t0217800-01

Locus

Os01g0217800

Description

ThiJ/PfpI domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1B, DJ-1B

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein B, DJ-1 protein B

Transcript Evidence

AK100463 (DDBJ, Best hit)

Protein Evidence

B6TVM7 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

ThiJ/PfpI (IPR002818)

DJ-1 (IPR006287)

Full-length cDNA

J023092A20 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0217800-01)

RiceXPro (AK100463)

Others

Oryzabase (20913)

KEGG (Os01t0217800-01)

Transcript

1723 bp

>Os01t0217800-01 ThiJ/PfpI domain containing protein.
AGTAGTACAGCGCACAGGCCACGCGTGCGCGTCCACCGAAACAGCGGCGGCGACGACGAG
GCGATCGATTCCTGGACACTCGCGCCACGCCACCCCACTGTCCCTGCACGCTGCAGCTAC
CCCTACTCTACCACTGCCCTCTCCGGCAGGGAAGCGAGGAAGAGGCACGCACCACGAAGT
CGCCACCTCGATTTTTCCGGCGAACGACGCAAGAATAACACCCCCCCCCCCCTTACCTAC
GGGGATAGTGATACGATGGCGATGGCGGCCGCTTCCGCCTCCGCCATGGCGAGGCGGGCC
GCTTCGTGGCCACGGCTCCTCCTCCTCTCCCGCGCCTTCGCCGCCGCCGCCGCTGAGCCG
AAGCGGGTGCTCGTGCCGGTCGCGGACGGCACGGAGCCGGTGGAGGCGGCCGCCACCGCC
GACGTGCTCAACCGCGCCGGCGCGCGGGTCACCGTCGCCACGGCTGACCCCGCGGGCGAC
GACCGTGGCCTCCTGGTGGAGGCCGCGTTCGGGGTCAAGCTCGTCGCCGACGGCCGCGTC
GCCGACCTGGAAGGCGAGGCCTTTGACCTCATCGCCCTACCCGGAGGAATGCCGGGATCA
GCTAACCTCAGAGATTGCAAGGTGCTGGAGAAGATGGTCAAGAAGCAGGCAGAGCAGGGT
GGCCTCTACGCCGCCATCTGCGCCACGCCGGCGGTGACGCTGGCTCACTGGGGCTTGCTC
AAAGGCTTAAAGGCGACTTGCTATCCATCATTCATGGAGAAGTTCACCGCTGAAATTATC
CCTGTGAACTCTAGGGTGGTGGTAGATAGAAATGCAGTGACCAGCCAAGGGCCAGCAACA
GCAATTGAATATGCTCTCGCTTTGGTGGAGCAACTGTACGGCAAAGAGAAGTCGGAGGAG
GTTGCAGGACCCTTGTATGTTCGTCCTCAACCTGGGGTTGACTATGTCATAGATGAGTTC
AATTCAGTTGAGTGGAAATGCAGTGGTACACCTCAGGTTCTTGTGCCAGTTGCTAATGGT
TCGGAGGAAATGGAAGCTCTTAATTTAATAGATATCTTGCGTAGAGCAGGAGCAAATGTT
ACTGTTGCATCAGTTGAGGATAAGTTGCAAGTTGTGACCCGCCGCCACAAATTTAACCTG
ATAGCTGATATTATGGTGGAAGAAGCTGCCAAAAGGGAATTCGATCTGATTGTCATGCCG
GGTGGTCTGCCAGGTGCTCAAAAGCTTTCTAGTACAAAGGTACTTGTAGATTTACTAAAG
AAACAGGCAGAATCTAATAAACCATATGGTGCAATATGCGCTTCTCCTGCTTATGTTCTC
GAGCCCCATGGTTTACTGAAGGGGAAGAAGGCAACATCATTTCCACCAATGGCACACCTG
CTTACTGATCAGAGTGCATGTGACAGTAGGGTGGTTGTTGATGGTAACCTTATCACTAGC
AAAGCCCCAGGCTCCGCGACAGAGTTCGCGCTAGCCATTGTTGAGAAGCTGTTTGGTCGA
GAGAAAGCGGTCAGTATAGCGAAGGAGTTGATTTTTATGTGATTATACACTTGGGCATTT
ATGCATCAGGTGCCTGTCACCTGTGAGTGATGCTTCTGTGAATAACTACTTATGCTGCTT
TCCTAGGAATGCATAATATAAGCCTATAGCAGCATGTGGCAATCCATGTGAATGAGGAAT
AAATGTACATTATGAGTATCATGTGTAAAGAGTCGTCGTTGTT

CDS

1287 bp

>Os01t0217800-01 ThiJ/PfpI domain containing protein.
ATGGCGATGGCGGCCGCTTCCGCCTCCGCCATGGCGAGGCGGGCCGCTTCGTGGCCACGG
CTCCTCCTCCTCTCCCGCGCCTTCGCCGCCGCCGCCGCTGAGCCGAAGCGGGTGCTCGTG
CCGGTCGCGGACGGCACGGAGCCGGTGGAGGCGGCCGCCACCGCCGACGTGCTCAACCGC
GCCGGCGCGCGGGTCACCGTCGCCACGGCTGACCCCGCGGGCGACGACCGTGGCCTCCTG
GTGGAGGCCGCGTTCGGGGTCAAGCTCGTCGCCGACGGCCGCGTCGCCGACCTGGAAGGC
GAGGCCTTTGACCTCATCGCCCTACCCGGAGGAATGCCGGGATCAGCTAACCTCAGAGAT
TGCAAGGTGCTGGAGAAGATGGTCAAGAAGCAGGCAGAGCAGGGTGGCCTCTACGCCGCC
ATCTGCGCCACGCCGGCGGTGACGCTGGCTCACTGGGGCTTGCTCAAAGGCTTAAAGGCG
ACTTGCTATCCATCATTCATGGAGAAGTTCACCGCTGAAATTATCCCTGTGAACTCTAGG
GTGGTGGTAGATAGAAATGCAGTGACCAGCCAAGGGCCAGCAACAGCAATTGAATATGCT
CTCGCTTTGGTGGAGCAACTGTACGGCAAAGAGAAGTCGGAGGAGGTTGCAGGACCCTTG
TATGTTCGTCCTCAACCTGGGGTTGACTATGTCATAGATGAGTTCAATTCAGTTGAGTGG
AAATGCAGTGGTACACCTCAGGTTCTTGTGCCAGTTGCTAATGGTTCGGAGGAAATGGAA
GCTCTTAATTTAATAGATATCTTGCGTAGAGCAGGAGCAAATGTTACTGTTGCATCAGTT
GAGGATAAGTTGCAAGTTGTGACCCGCCGCCACAAATTTAACCTGATAGCTGATATTATG
GTGGAAGAAGCTGCCAAAAGGGAATTCGATCTGATTGTCATGCCGGGTGGTCTGCCAGGT
GCTCAAAAGCTTTCTAGTACAAAGGTACTTGTAGATTTACTAAAGAAACAGGCAGAATCT
AATAAACCATATGGTGCAATATGCGCTTCTCCTGCTTATGTTCTCGAGCCCCATGGTTTA
CTGAAGGGGAAGAAGGCAACATCATTTCCACCAATGGCACACCTGCTTACTGATCAGAGT
GCATGTGACAGTAGGGTGGTTGTTGATGGTAACCTTATCACTAGCAAAGCCCCAGGCTCC
GCGACAGAGTTCGCGCTAGCCATTGTTGAGAAGCTGTTTGGTCGAGAGAAAGCGGTCAGT
ATAGCGAAGGAGTTGATTTTTATGTGA

Protein

429 aa

>Os01t0217800-01 ThiJ/PfpI domain containing protein.
MAMAAASASAMARRAASWPRLLLLSRAFAAAAAEPKRVLVPVADGTEPVEAAATADVLNR
AGARVTVATADPAGDDRGLLVEAAFGVKLVADGRVADLEGEAFDLIALPGGMPGSANLRD
CKVLEKMVKKQAEQGGLYAAICATPAVTLAHWGLLKGLKATCYPSFMEKFTAEIIPVNSR
VVVDRNAVTSQGPATAIEYALALVEQLYGKEKSEEVAGPLYVRPQPGVDYVIDEFNSVEW
KCSGTPQVLVPVANGSEEMEALNLIDILRRAGANVTVASVEDKLQVVTRRHKFNLIADIM
VEEAAKREFDLIVMPGGLPGAQKLSSTKVLVDLLKKQAESNKPYGAICASPAYVLEPHGL
LKGKKATSFPPMAHLLTDQSACDSRVVVDGNLITSKAPGSATEFALAIVEKLFGREKAVS
IAKELIFM*

5'UTR

chr01:6432336..6432590 (+ strand) : 255 bp

CDS

chr01:6432591..6432917 (+ strand) : 327 bp

chr01:6433356..6433505 (+ strand) : 150 bp

chr01:6433614..6433796 (+ strand) : 183 bp

chr01:6434305..6434385 (+ strand) : 81 bp

chr01:6434646..6434849 (+ strand) : 204 bp

chr01:6434933..6435073 (+ strand) : 141 bp

chr01:6435270..6435470 (+ strand) : 201 bp

3'UTR

chr01:6435471..6435651 (+ strand) : 181 bp

FASTA

>Os01t0217800-01 class=Sequence position=chr01:6432336..6435651 (+ strand)
AGTAGTACAG CGCACAGGCC ACGCGTGCGC GTCCACCGAA ACAGCGGCGG CGACGACGAG GCGATCGATT CCTGGACACT
CGCGCCACGC CACCCCACTG TCCCTGCACG CTGCAGCTAC CCCTACTCTA CCACTGCCCT CTCCGGCAGG GAAGCGAGGA
AGAGGCACGC ACCACGAAGT CGCCACCTCG ATTTTTCCGG CGAACGACGC AAGAATAACA CCCCCCCCCC CCTTACCTAC
GGGGATAGTG ATACGATGGC GATGGCGGCC GCTTCCGCCT CCGCCATGGC GAGGCGGGCC GCTTCGTGGC CACGGCTCCT
CCTCCTCTCC CGCGCCTTCG CCGCCGCCGC CGCTGAGCCG AAGCGGGTGC TCGTGCCGGT CGCGGACGGC ACGGAGCCGG
TGGAGGCGGC CGCCACCGCC GACGTGCTCA ACCGCGCCGG CGCGCGGGTC ACCGTCGCCA CGGCTGACCC CGCGGGCGAC
GACCGTGGCC TCCTGGTGGA GGCCGCGTTC GGGGTCAAGC TCGTCGCCGA CGGCCGCGTC GCCGACCTGG AAGGCGAGGC
CTTTGACCTC ATCGCCCTAC CCGTGCGTCC ACCCTTTACT CCTAAAATTA CTTCCTTTTT TTTCTCCCCC TTAACAACTA
CTCCCTCCGT TGctccctcc gtttcatatt actagtcgat ttaacttttg caaacatttt taagtttgac caaatttata
gaaaaatata acaatacgaa gcaaacgtat tatgaaaata tatttaacat tacatttaat tgaactaatc tagtgttcca
gatattgcta aatttttcat taaatttggt caaacataaa gaaatttgac gaagaaaaaa aaaggtcaaa gtgacttata
atatgaaatg gagggagtaC TAATTCTGCT TTACTGTGCC ATTGATTCGC GCTCTGTGAG GATGTTCTTG CTTAATAAGA
GAGAACTTGT ATGGACTAGC AAAAGTGTGA CAATTCAGTG ATGCTGGTTA CTTGGTGTAG GGAGGAATGC CGGGATCAGC
TAACCTCAGA GATTGCAAGG TGCTGGAGAA GATGGTCAAG AAGCAGGCAG AGCAGGGTGG CCTCTACGCC GCCATCTGCG
CCACGCCGGC GGTGACGCTG GCTCACTGGG GCTTGCTCAA AGGCTTAAAG GTTGCAACAT GGATCATCAT TCAGTCAGGG
TCAATTCACT GTTGCGGGGG TGGTTTTGTT GGAAATATGT ATCATGTTGA GAGACAGATA TGATTTTTGT TATTTCAGGC
GACTTGCTAT CCATCATTCA TGGAGAAGTT CACCGCTGAA ATTATCCCTG TGAACTCTAG GGTGGTGGTA GATAGAAATG
CAGTGACCAG CCAAGGGCCA GCAACAGCAA TTGAATATGC TCTCGCTTTG GTGGAGCAAC TGTACGGCAA AGAGAAGTCG
GAGGAGGTTG CAGGACCCTT GGTAAGCTAT ATAGCCTGTA AGCCATCACA TACTTGTTTT TTTTTACTTC TATCTGCTAT
GTTAGGTGAT ATGATATTAT TACCAGGCGA TGATCTCAAA GAGATGTTTA TGGGCTGTTG GATTTTCCTA AAATTCTGCC
TGCAGTGATT CAATCAATTA TCTGAGTGAT TTATGGTTTC TAACTAGTTG ACATAATTAT AATCATACTG AAATTTAGAG
TAAGGCAATA TGTCGCAATC TTTTAGGACA TTtttttttc cgaacgcgca aaaggattgc acgtcaatat attagcagga
aaagagtttt tGTTACACAT TTAGGACATT TAATTGTTAC TGTAATCTCT CCCTTCAAAT CTTAATACAA ATGATACGCA
ATGCTTATGC GTGTTCCCTA AAAAAAGTTA CTTTTGCTGA GTTCACTCGA ATTGTTTTCG TGCATATTGT ATCAACATCA
GCTGCTTAAA TTAACATTGC CTAATGATTG TGTGGTTCTT CTAATTCAGT ATGTTCGTCC TCAACCTGGG GTTGACTATG
TCATAGATGA GTTCAATTCA GTTGAGTGGA AATGCAGTGG TACACCTCAG GTATGAAATA AAATTGAATC CTTTTGTTAA
AAAATGCCTC CTTATATACA TTTTTAAGGT TGCATGAATA GGTTCTTGTC CCATGGCACA GGTCTTCGCC TGCTTAAAAA
TGTTTTAGCT GTTGCTATGA AATTCTGTCA TTTTTTTTTC GCCGGGCTGC AGGAAGGAAT CCCTGGTCAG GGTTTATTAA
GTAAGCATAA GGTGTGATTT ACATGACTCA ACAACCATGC TAGCACTTCC CTTTTTTGGG TCTTCTGCAG GTTCTTGTGC
CAGTTGCTAA TGGTTCGGAG GAAATGGAAG CTCTTAATTT AATAGATATC TTGCGTAGAG CAGGAGCAAA TGTTACTGTT
GCATCAGTTG AGGATAAGTT GCAAGTTGTG ACCCGCCGCC ACAAATTTAA CCTGATAGCT GATATTATGG TGGAAGAAGC
TGCCAAAAGG GAATTCGATC TGATTGTCAT GCCGGTACAT TCCATAGCTA GAGTTACTTT TTGATTGATC TGGTGTTGAT
CTTTTGAATA CTTCGCTGAT ACTGGTGTCA TATATAGGGT GGTCTGCCAG GTGCTCAAAA GCTTTCTAGT ACAAAGGTAC
TTGTAGATTT ACTAAAGAAA CAGGCAGAAT CTAATAAACC ATATGGTGCA ATATGCGCTT CTCCTGCTTA TGTTCTCGAG
CCCCATGGTT TACTGAAGGT ATTCCCCTTT ATATGTGCAT GAGTGTTAAT CCCTCTCGGT AGTCAGCTCT TTTTTTTTTG
GAACAAATTC AGTAGTCAGC TCCATAGGCA TATAAATGAT TATTCCTCAA AGTAGCAGAT TAACCATCAA GCTGTATTTC
CTTTTGAAAA AAAACTGTCA AGCTGTATTA ACATAGATGT TTCCATCATT TTAGGGGAAG AAGGCAACAT CATTTCCACC
AATGGCACAC CTGCTTACTG ATCAGAGTGC ATGTGACAGT AGGGTGGTTG TTGATGGTAA CCTTATCACT AGCAAAGCCC
CAGGCTCCGC GACAGAGTTC GCGCTAGCCA TTGTTGAGAA GCTGTTTGGT CGAGAGAAAG CGGTCAGTAT AGCGAAGGAG
TTGATTTTTA TGTGATTATA CACTTGGGCA TTTATGCATC AGGTGCCTGT CACCTGTGAG TGATGCTTCT GTGAATAACT
ACTTATGCTG CTTTCCTAGG AATGCATAAT ATAAGCCTAT AGCAGCATGT GGCAATCCAT GTGAATGAGG AATAAATGTA
CATTATGAGT ATCATGTGTA AAGAGTCGTC GTTGTT

Locus: Os01g0217800

Loading...

Locus: Os01g0217800

Loading...