Os01t0218800-01

Locus

Os01g0218800

Description

TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development

RAP-DB Gene Symbol Synonym(s)

SDG721

RAP-DB Gene Name Synonym(s)

SET-domain group protein 721

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET1, SDG721

Oryzabase Gene Name Synonym(s)

SET protein 1

Transcript Evidence

AK120836

Protein Evidence

Q0JPK0

Literature

PMID: 29473711

Note

Manual Curation

April 14, 2020

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, FYVE/PHD-type (IPR011011)

Histone-lysine N-methyltransferase ATX (IPR025780)

PWWP domain (IPR000313)

Zinc finger, PHD-type (IPR001965)

Zinc finger, PHD-finger (IPR019787)

Extended PHD (ePHD) domain (IPR034732)

ATX3/4/5, PHD domain (IPR042011)

SET domain (IPR001214)

Post-SET domain (IPR003616)

Zinc finger, PHD-type, conserved site (IPR019786)

Full-length cDNA

J023020K07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0218800-01)

Others

Oryzabase (13370)

Transcript

3396 bp

>Os01t0218800-01 TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development
GAACCCTAACACGCGGAGGATTTGGCCACCGACGAGTTGGGGGGAGGAAGGGAGTTCAAT
TCTAGGGTTTTGTTTCGGCGCGGCGGGGATGctcgcgtcccgcatcccgctcaagcgctg
caccgccgccgccgtcgtccccctccccggggagTTGGAGATGGAGGAGGGGCCCACCCC
CCCCGCCGGGGGTGGTGAGGGGAGCGGCGCGGCGGTGGTGCCCGCCAAGCGCCGCCGCGA
GCGGGTGGTCCCCTCGCGGTTTAGGGACTCGGTGGTGTCGCTGCCGCTGCCGCCCGCGAA
GAAGGGGAGGCCCGCGAAGAAGGCGGCCGCGCGGGAGGGCGGGGACGGGGAGGTGTACGA
TGTGGAGGTGCGCGCGGTGGAGCAACAAGGCGCGACGGCGGCGGCCTTCGGCGCCGTGGA
GACCGCGGTGTGGCCCGGCGACGAGCGGCCGGCGCAGACGGAGGAGGAGCTGTACCGGGC
GTGCAGGAATATCCGCAGGAGCAGCAGCTCCAGCGGGTTCAGCGGCAGCGTGGTGACGTC
GCTGAGCAATGCCGGCGGGAGCGTGGCGCCGGAGGGGAAGCCCGTGGTGGTGGTGGAGTG
CAAGCCGAAGAGGGAGGGCGGCGATAAAAAGGAGGATTTTTACTGGCCGGAGGATTTCGT
GCTGGGTGATGTCGTGTGGGCGAGGTCCGGGAAGAAGTGCCCAGCATGGCCTGCGGTGGT
GATTGACCCACTGCTCCACGCGCCAGCGGTCGTGTTGAACTCCTGCATCCCGGGTGCACT
CTGCGTCATGTTCTTTGGATTCTCTTCTGGCGGGCATGGCAGGGACTATGGATGGATTAA
GCAAGGGATGATCTTTCCATTTGTGGACTACTTAGACCGGTTTCAGGGTCAGGCTTTGTA
TAAACTCAAGGCAAACAGATTCCGTCAAGCAATTGAGGAGGCTTTCCTTGCTGAGCGTGG
GTTTTGTGAGCTCGAAATGGATGAGGGGTGCTCACTAGAGAAGTCTGTCAATGACCAGTC
TGTCCCTGACGGGTTACAGGAAGGGAGTGGTTCTAACAATGACCAGGAATGTCAATCGGA
GGCTCAGGTTGTTGGCAAATCAACTGGATGTTGTGATAGTTGTGGTAATCGTGTTCCACC
CAAGATCGCGAAGAAAAAGAAGCAAGCGGGAGAGCAGTTACTCTGTAGACACTGTGATAA
GCTATTGCAGTCAAAGCAGTACTGTGGCATATGCAAGAAAATCTGGCACCACACAGATGG
TGGAAATTGGGTTTGTTGTGATGAGTGTCAAATTTGGGTTCACGTAGAATGTGACCTAAC
ATGCATCAACATGGAGGACTTAGAAAATGCCGATTACTTCTGTCCAGATTGCAAATCAAA
ACGCAAGACAGTACCTCCTGTTGAACAAATGAACACTCCGAACAGTTCAGAATGTGCTAG
CACTTCTAAGGAAAAACTGCCGGAAATGATACCTGTGTTCTGCTTTGGGATGGACGGAAT
GTATTTACCTAAGAAGCACATGATACTATGCCAATGTAATTCTTGCAAAGAAAGGCTGAT
GAGTCTGAGTGAGTGGGAGAGACATACTGGTTCAAGGAAGAAGAACTGGAAGATGAGCGT
TAAACTTAAGAGCAATGGGGATCCATTGGTAACCTTGTTGGATGATATTCCCTGCGCAAA
TGTGAAGTCTTCTACACCAAGTATTAATAAAGAAGAGTTGCTGAAATTGCTAGCAAATTC
TTTTAGACCTGTCAATGCTAGATGGACAACTGAACGTTGTGCTGTTTGTCGATGGGTTGA
GGATTGGGACTACAATAAAATTATTATTTGCAACAGATGCCAAATAGCTGTCCACCAAGA
GTGCTATGGAGCACGTGATGTACAAGATTTTACAAATTGGGTCTGTCGAGCATGTGAATT
GCCGAAACAAAAAAGAGAATGTTGTCTTTGTCCTGTCAAAGGCGGTGCTCTCAAGCCAAC
AGATATTGACCAACTATGGGTTCATGTTACATGTGCCTGGTTTCAACCTAAAGTCTCTTT
TCCTGTTGATGAGACAATGGAGCCAGCCATGGGCATATTGAGCATCCCTTCAGAGTACTT
TAAGAAGGCATGTGTTATATGCAAGCAGATGCATGGTGCCTGCACTCAGTGCTACAAGTG
CTCTACTTATTATCATGCAATGTGTGCATCAAGAGCAGGATATCGCATGGAGTTGCAATA
CTCTGAAAAAAATGGAAGGAACATAACAAGAATGGTTTCCTACTGTGCATTTCACAGTAC
TCCTGACCCAGATAATGTCTTGATAGTTAAGACGCCTGAAGGAGTTTTCTCAACCAAATT
TTTGCCCCAAAATAATGAGAAACAGAGTGGTACAAGACTTGTCAGGAAAGAGAATCTACA
GGAGAAAGTCCTTCCTGCTAAAATTTCTGACTGTCCAGCTGCAAGGTGCCTACCTTATGA
AATGCTGAAAAATAAGAAAGAACCAGGAGAGGCAATTGCCCACAGAATAATGGGACCCCG
ACATCATTCCCAAGAGTCAATTGAGGGTTTGAACGCTTGCATGGATCAAAAGGATGAAAA
ATCCTTCGCAACTTTTAGAGAACGACTTCGGTATTTACAGAAAATAGAAAACAAAAGGGT
CTCTTGTGGTCGATCTGGAATACATGGATGGGGACTCTTTGCTGCTAAGAAAATCCAGGA
GGGGCAAATGGTTATCGAATATCGCGGTGACCAAGTTAGACGTAGTGTTGCAGATTTGAG
GGAAGCACGATATCACAGGGAGAAGAAAGATTGTTATCTGTTCAAGATCAGCGAAGACGT
TGTCGTTGATGCAACAGAGAAAGGGAACATAGCCCGCCTAATTAATCACTCGTGTATGCC
TAATTGCTACGCAAGGATCATGAGTGTTGGCGATGAAAAGAGCCAGATAATTCTTATCGC
CAAAAGAGACGTCTCCGCTGGCGAAGAACTAACCTATGACTACTTGTTTGACCCTGACGA
GTCCGAGGACTGCAGGGTCCCTTGTCTGTGTAAAGCTCTTAACTGCCGTGGATACATGAA
CTGAAGTGAACATTCTCACAAGTCACAAGGCTAACCCCCCTTAACCATGCCAAAGGGCTA
TATTCTCAGATTCATCATGATTCTTTCGTTTATTCAAAGGCTGGTTGTCAAACAAGCATC
AAAGTTTGTGATTTTTTTACACAAATTTTGCTAGATAGCGAGGCTGGATTGGATTTACCG
GTTTCAGACTTTCGGTGAGAGCATAGCAGGCACCTGGCAATTTAGCAACACGCTGCCAGA
GCCCCTTGTAAATTCTTCTTACTTTGATGTAATAATAAGATGATTAAGTTGTTAATGCCT
TTTCTCCATGATGAAAAGAAAGAGAAATGAATATCC

CDS

2976 bp

>Os01t0218800-01 TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development
ATGctcgcgtcccgcatcccgctcaagcgctgcaccgccgccgccgtcgtccccctcccc
ggggagTTGGAGATGGAGGAGGGGCCCACCCCCCCCGCCGGGGGTGGTGAGGGGAGCGGC
GCGGCGGTGGTGCCCGCCAAGCGCCGCCGCGAGCGGGTGGTCCCCTCGCGGTTTAGGGAC
TCGGTGGTGTCGCTGCCGCTGCCGCCCGCGAAGAAGGGGAGGCCCGCGAAGAAGGCGGCC
GCGCGGGAGGGCGGGGACGGGGAGGTGTACGATGTGGAGGTGCGCGCGGTGGAGCAACAA
GGCGCGACGGCGGCGGCCTTCGGCGCCGTGGAGACCGCGGTGTGGCCCGGCGACGAGCGG
CCGGCGCAGACGGAGGAGGAGCTGTACCGGGCGTGCAGGAATATCCGCAGGAGCAGCAGC
TCCAGCGGGTTCAGCGGCAGCGTGGTGACGTCGCTGAGCAATGCCGGCGGGAGCGTGGCG
CCGGAGGGGAAGCCCGTGGTGGTGGTGGAGTGCAAGCCGAAGAGGGAGGGCGGCGATAAA
AAGGAGGATTTTTACTGGCCGGAGGATTTCGTGCTGGGTGATGTCGTGTGGGCGAGGTCC
GGGAAGAAGTGCCCAGCATGGCCTGCGGTGGTGATTGACCCACTGCTCCACGCGCCAGCG
GTCGTGTTGAACTCCTGCATCCCGGGTGCACTCTGCGTCATGTTCTTTGGATTCTCTTCT
GGCGGGCATGGCAGGGACTATGGATGGATTAAGCAAGGGATGATCTTTCCATTTGTGGAC
TACTTAGACCGGTTTCAGGGTCAGGCTTTGTATAAACTCAAGGCAAACAGATTCCGTCAA
GCAATTGAGGAGGCTTTCCTTGCTGAGCGTGGGTTTTGTGAGCTCGAAATGGATGAGGGG
TGCTCACTAGAGAAGTCTGTCAATGACCAGTCTGTCCCTGACGGGTTACAGGAAGGGAGT
GGTTCTAACAATGACCAGGAATGTCAATCGGAGGCTCAGGTTGTTGGCAAATCAACTGGA
TGTTGTGATAGTTGTGGTAATCGTGTTCCACCCAAGATCGCGAAGAAAAAGAAGCAAGCG
GGAGAGCAGTTACTCTGTAGACACTGTGATAAGCTATTGCAGTCAAAGCAGTACTGTGGC
ATATGCAAGAAAATCTGGCACCACACAGATGGTGGAAATTGGGTTTGTTGTGATGAGTGT
CAAATTTGGGTTCACGTAGAATGTGACCTAACATGCATCAACATGGAGGACTTAGAAAAT
GCCGATTACTTCTGTCCAGATTGCAAATCAAAACGCAAGACAGTACCTCCTGTTGAACAA
ATGAACACTCCGAACAGTTCAGAATGTGCTAGCACTTCTAAGGAAAAACTGCCGGAAATG
ATACCTGTGTTCTGCTTTGGGATGGACGGAATGTATTTACCTAAGAAGCACATGATACTA
TGCCAATGTAATTCTTGCAAAGAAAGGCTGATGAGTCTGAGTGAGTGGGAGAGACATACT
GGTTCAAGGAAGAAGAACTGGAAGATGAGCGTTAAACTTAAGAGCAATGGGGATCCATTG
GTAACCTTGTTGGATGATATTCCCTGCGCAAATGTGAAGTCTTCTACACCAAGTATTAAT
AAAGAAGAGTTGCTGAAATTGCTAGCAAATTCTTTTAGACCTGTCAATGCTAGATGGACA
ACTGAACGTTGTGCTGTTTGTCGATGGGTTGAGGATTGGGACTACAATAAAATTATTATT
TGCAACAGATGCCAAATAGCTGTCCACCAAGAGTGCTATGGAGCACGTGATGTACAAGAT
TTTACAAATTGGGTCTGTCGAGCATGTGAATTGCCGAAACAAAAAAGAGAATGTTGTCTT
TGTCCTGTCAAAGGCGGTGCTCTCAAGCCAACAGATATTGACCAACTATGGGTTCATGTT
ACATGTGCCTGGTTTCAACCTAAAGTCTCTTTTCCTGTTGATGAGACAATGGAGCCAGCC
ATGGGCATATTGAGCATCCCTTCAGAGTACTTTAAGAAGGCATGTGTTATATGCAAGCAG
ATGCATGGTGCCTGCACTCAGTGCTACAAGTGCTCTACTTATTATCATGCAATGTGTGCA
TCAAGAGCAGGATATCGCATGGAGTTGCAATACTCTGAAAAAAATGGAAGGAACATAACA
AGAATGGTTTCCTACTGTGCATTTCACAGTACTCCTGACCCAGATAATGTCTTGATAGTT
AAGACGCCTGAAGGAGTTTTCTCAACCAAATTTTTGCCCCAAAATAATGAGAAACAGAGT
GGTACAAGACTTGTCAGGAAAGAGAATCTACAGGAGAAAGTCCTTCCTGCTAAAATTTCT
GACTGTCCAGCTGCAAGGTGCCTACCTTATGAAATGCTGAAAAATAAGAAAGAACCAGGA
GAGGCAATTGCCCACAGAATAATGGGACCCCGACATCATTCCCAAGAGTCAATTGAGGGT
TTGAACGCTTGCATGGATCAAAAGGATGAAAAATCCTTCGCAACTTTTAGAGAACGACTT
CGGTATTTACAGAAAATAGAAAACAAAAGGGTCTCTTGTGGTCGATCTGGAATACATGGA
TGGGGACTCTTTGCTGCTAAGAAAATCCAGGAGGGGCAAATGGTTATCGAATATCGCGGT
GACCAAGTTAGACGTAGTGTTGCAGATTTGAGGGAAGCACGATATCACAGGGAGAAGAAA
GATTGTTATCTGTTCAAGATCAGCGAAGACGTTGTCGTTGATGCAACAGAGAAAGGGAAC
ATAGCCCGCCTAATTAATCACTCGTGTATGCCTAATTGCTACGCAAGGATCATGAGTGTT
GGCGATGAAAAGAGCCAGATAATTCTTATCGCCAAAAGAGACGTCTCCGCTGGCGAAGAA
CTAACCTATGACTACTTGTTTGACCCTGACGAGTCCGAGGACTGCAGGGTCCCTTGTCTG
TGTAAAGCTCTTAACTGCCGTGGATACATGAACTGA

Protein

992 aa

>Os01t0218800-01 TRITHORAX-like protein, Regulation of H3K4 methylation, Regulation of plant height and pollen grain development
MLASRIPLKRCTAAAVVPLPGELEMEEGPTPPAGGGEGSGAAVVPAKRRRERVVPSRFRD
SVVSLPLPPAKKGRPAKKAAAREGGDGEVYDVEVRAVEQQGATAAAFGAVETAVWPGDER
PAQTEEELYRACRNIRRSSSSSGFSGSVVTSLSNAGGSVAPEGKPVVVVECKPKREGGDK
KEDFYWPEDFVLGDVVWARSGKKCPAWPAVVIDPLLHAPAVVLNSCIPGALCVMFFGFSS
GGHGRDYGWIKQGMIFPFVDYLDRFQGQALYKLKANRFRQAIEEAFLAERGFCELEMDEG
CSLEKSVNDQSVPDGLQEGSGSNNDQECQSEAQVVGKSTGCCDSCGNRVPPKIAKKKKQA
GEQLLCRHCDKLLQSKQYCGICKKIWHHTDGGNWVCCDECQIWVHVECDLTCINMEDLEN
ADYFCPDCKSKRKTVPPVEQMNTPNSSECASTSKEKLPEMIPVFCFGMDGMYLPKKHMIL
CQCNSCKERLMSLSEWERHTGSRKKNWKMSVKLKSNGDPLVTLLDDIPCANVKSSTPSIN
KEELLKLLANSFRPVNARWTTERCAVCRWVEDWDYNKIIICNRCQIAVHQECYGARDVQD
FTNWVCRACELPKQKRECCLCPVKGGALKPTDIDQLWVHVTCAWFQPKVSFPVDETMEPA
MGILSIPSEYFKKACVICKQMHGACTQCYKCSTYYHAMCASRAGYRMELQYSEKNGRNIT
RMVSYCAFHSTPDPDNVLIVKTPEGVFSTKFLPQNNEKQSGTRLVRKENLQEKVLPAKIS
DCPAARCLPYEMLKNKKEPGEAIAHRIMGPRHHSQESIEGLNACMDQKDEKSFATFRERL
RYLQKIENKRVSCGRSGIHGWGLFAAKKIQEGQMVIEYRGDQVRRSVADLREARYHREKK
DCYLFKISEDVVVDATEKGNIARLINHSCMPNCYARIMSVGDEKSQIILIAKRDVSAGEE
LTYDYLFDPDESEDCRVPCLCKALNCRGYMN*

5'UTR

chr01:6514553..6514640 (- strand) : 88 bp

CDS

chr01:6513818..6514552 (- strand) : 735 bp

chr01:6513545..6513600 (- strand) : 56 bp

chr01:6513241..6513448 (- strand) : 208 bp

chr01:6513034..6513147 (- strand) : 114 bp

chr01:6512868..6512936 (- strand) : 69 bp

chr01:6512698..6512763 (- strand) : 66 bp

chr01:6512484..6512578 (- strand) : 95 bp

chr01:6512298..6512387 (- strand) : 90 bp

chr01:6511734..6511869 (- strand) : 136 bp

chr01:6511521..6511596 (- strand) : 76 bp

chr01:6511335..6511437 (- strand) : 103 bp

chr01:6511100..6511224 (- strand) : 125 bp

chr01:6510726..6510871 (- strand) : 146 bp

chr01:6510502..6510606 (- strand) : 105 bp

chr01:6510113..6510177 (- strand) : 65 bp

chr01:6509585..6509783 (- strand) : 199 bp

chr01:6508906..6508992 (- strand) : 87 bp

chr01:6508759..6508815 (- strand) : 57 bp

chr01:6508593..6508682 (- strand) : 90 bp

chr01:6508359..6508445 (- strand) : 87 bp

chr01:6508110..6508184 (- strand) : 75 bp

chr01:6507919..6508019 (- strand) : 101 bp

chr01:6507700..6507790 (- strand) : 91 bp

3'UTR

chr01:6507368..6507699 (- strand) : 332 bp

FASTA

>Os01t0218800-01 class=Sequence position=chr01:6507368..6514640 (- strand)
GAACCCTAAC ACGCGGAGGA TTTGGCCACC GACGAGTTGG GGGGAGGAAG GGAGTTCAAT TCTAGGGTTT TGTTTCGGCG
CGGCGGGGAT Gctcgcgtcc cgcatcccgc tcaagcgctg caccgccgcc gccgtcgtcc ccctccccgg ggagTTGGAG
ATGGAGGAGG GGCCCACCCC CCCCGCCGGG GGTGGTGAGG GGAGCGGCGC GGCGGTGGTG CCCGCCAAGC GCCGCCGCGA
GCGGGTGGTC CCCTCGCGGT TTAGGGACTC GGTGGTGTCG CTGCCGCTGC CGCCCGCGAA GAAGGGGAGG CCCGCGAAGA
AGGCGGCCGC GCGGGAGGGC GGGGACGGGG AGGTGTACGA TGTGGAGGTG CGCGCGGTGG AGCAACAAGG CGCGACGGCG
GCGGCCTTCG GCGCCGTGGA GACCGCGGTG TGGCCCGGCG ACGAGCGGCC GGCGCAGACG GAGGAGGAGC TGTACCGGGC
GTGCAGGAAT ATCCGCAGGA GCAGCAGCTC CAGCGGGTTC AGCGGCAGCG TGGTGACGTC GCTGAGCAAT GCCGGCGGGA
GCGTGGCGCC GGAGGGGAAG CCCGTGGTGG TGGTGGAGTG CAAGCCGAAG AGGGAGGGCG GCGATAAAAA GGAGGATTTT
TACTGGCCGG AGGATTTCGT GCTGGGTGAT GTCGTGTGGG CGAGGTCCGG GAAGAAGTGC CCAGCATGGC CTGCGGTGGT
GATTGACCCA CTGCTCCACG CGCCAGCGGT CGTGTTGAAC TCCTGCATCC CGGGTGCACT CTGCGTCATG TTCTTTGGAT
TCTCTTCTGG CGGGCATGGC AGGGTAAGCT TTGTGGGGTG TTGGTTTTTG TTTTGTCCTT GAAATCCACA ACCCAACATT
TAAATGTGAT TTTTTTTTTG AATTTAAATG TGGAATAAGA GTTCCACGAA GTGCAACTGA AACAGGGTAA ACCATGTGTC
GCATGGGCCA AACAGTCCCT TTCTGTTTTT TTTTTTTTGG TTTGCGTCAA CTTACAGTAC TGTATTTCTT TGCATCGCAG
GACTATGGAT GGATTAAGCA AGGGATGATC TTTCCATTTG TGGACTACTT AGACCGGTAA GCTACTGGCA TACGTTCGTT
TTTTTTTAAA AAAAATGCTG CTATGGGGAT TTATTTACCT GCGTGCTATC TGAAATTTCT TTGGTCTCCC AGGTTTCAGG
GTCAGGCTTT GTATAAACTC AAGGCAAACA GATTCCGTCA AGCAATTGAG GAGGCTTTCC TTGCTGAGCG TGGGTTTTGT
GAGCTCGAAA TGGATGAGGG GTGCTCACTA GAGAAGTCTG TCAATGACCA GTCTGTCCCT GACGGGTTAC AGGAAGGGAG
TGGTTCTAAC AATGACCAGG AATGTCAATC GGAGGCTCAG GTAAGTTCCG GATGCATCAC AAATGTAAAG ATATGAGCTT
GTGACTGCCT TATTACAACT TTCAGCTGAG CCGCAATCTA ATCAACACTG CAGGTTGTTG GCAAATCAAC TGGATGTTGT
GATAGTTGTG GTAATCGTGT TCCACCCAAG ATCGCGAAGA AAAAGAAGCA AGCGGGAGAG CAGTTACTCT GTAGACACTG
TGATAAGGTA TGCGGCCGTA CATTTGAGAT GGGTTTTTGT GTGTTCCATT ACTGTTTTCT GTTTTTATGG TGCCTTATGT
GTGCAAATTT TATTATATCT GCAGCTATTG CAGTCAAAGC AGTACTGTGG CATATGCAAG AAAATCTGGC ACCACACAGA
TGGTGGAAAT TGGGTAAGAG CTTAGAAATA TATGTGTTTC GTCGCTGTTA TATTCTACAT GTTCTCTTGA TTTGTCCATG
GGTCAAGGCT CACAACCTGC AACACCCTTC TTTGCAGGTT TGTTGTGATG AGTGTCAAAT TTGGGTTCAC GTAGAATGTG
ACCTAACATG CATCAACATG GAGGTAATCT GCTTCTTTTG TTTTGATGTT TATATTTTTT ATCCTATTGT TTGACACAGA
TATCGAACAG TTCTACGAAT AATAACTGTA TATAATTTGC TGACTCCAGT ACTGTTTTAT AGGACTTAGA AAATGCCGAT
TACTTCTGTC CAGATTGCAA ATCAAAACGC AAGACAGTAC CTCCTGTTGA ACAAATGAAC ACTCCGAACA GTTCAGAGTG
AGTTATTTAA TTTTTTCATC CAACCTATTG ACTTCTATTT AACGTTACTC AAATGATTAT AAGCATGCCA CTTTCTAATG
TATCTATACA CAGATGTGCT AGCACTTCTA AGGAAAAACT GCCGGAAATG ATACCTGTGT TCTGCTTTGG GATGGACGGA
ATGTATTTAC CTAAGAAGCA CATGTATGTA TTCTGCATAT CTTCTATTTA ATCTACAGCC AGCATGCTTC TTTAAGCTTA
TTACATGGAT ATCAATACTC TTTAAGTGAT TTTAGCGTGT TTTATTTCTC AATCCCCCAT ATCATGTAGA GTCATATGTT
CTTTGAAGGA CTACTAGATT TAGGTGATAG GTTATTTTCC TAGGGGCATA TATTTCTCTT TTGTTTCATT CATCTGGCAT
GAAAATTGAC ACTTAACCAA TTTAGCCATA TTGGATATTT TGTGCCACAA GGCTTAGAAG GCTCAATAAG AAAAACAACA
TTTGAAAGGT CGATTGTTCA ATATTAAAGA AATTCATGTA TTCCTTTCTT TCTAAAGGAC TATAAACTGA TTTCCTGATG
TGGCTGTGGC TGGTGCAACT GTTGGTATTG ACTTTGTATT GTTATTGGCA GGATACTATG CCAATGTAAT TCTTGCAAAG
AAAGGCTGAT GAGTCTGAGT GAGTGGGAGA GACATACTGG TTCAAGGAAG AAGAACTGGA AGATGAGCGT TAAACTTAAG
AGCAATGGGG ATCCATTGGT AACCTTGGTA AGCCTTTAAG ATCTTCATTT ATCTGAAAGT TGGTGGTCTA TAATGATCGC
TAAACTTGAA TTCACCTAGT TTTCAATAAA ATTCAAAGGT ATGAGAACTT GATATGACTT CTTTCATGTT TGTCTGACCT
TCAGTTGGAT GATATTCCCT GCGCAAATGT GAAGTCTTCT ACACCAAGTA TTAATAAAGA AGAGTTGCTG AAATTGCTAG
GTACATTGGC TCTTGAGTTT ATGTTGGTTT CTGCAGTTGG TGTGTGCAAC TTGTTTCACA ACAAATGAAT TTGATGCTTG
CAGCAAATTC TTTTAGACCT GTCAATGCTA GATGGACAAC TGAACGTTGT GCTGTTTGTC GATGGGTTGA GGATTGGGAC
TACAATAAAA TTATTATTTG CAACAGGTAT TTCCTGCTAA TCTTTGAGGT TTTTTTGACA CCCTTAGTTT ATGGATTCAT
TATATGTTTT AGGACTGCGT GTAGCTGAAA AACTTGTCCA AAATCTTTAT GTGCAGATGC CAAATAGCTG TCCACCAAGA
GTGCTATGGA GCACGTGATG TACAAGATTT TACAAATTGG GTCTGTCGAG CATGTGAATT GCCGAAACAA AAAAGAGAAT
GTTGTCTTTG TCCTGTCAAA GGTATCATTC CTGCCATGAT GTTGTATGTC ATCACAGTAT TGAATGATAC TGATACCTCA
CATTTTTTTC TGAGGCTTTC CAGTGTTCCT TATATTATGT TTATATGATG TACCCCATTT GATTAAATTG CAGTGGTGCT
TGGTGTCCAT TTTTCCTAGT CTTGGTTCGC TGCATTATAT TATTTTTTAA TGCTATCAGT ATTCACCTTT TCTTTTTTAA
TTGCTTTAGG CGGTGCTCTC AAGCCAACAG ATATTGACCA ACTATGGGTT CATGTTACAT GTGCCTGGTT TCAACCTAAA
GTCTCTTTTC CTGTTGATGA GACAATGGAG CCAGCCATGG GCATATTGAG CATCCCTTCA GAGTACTTTA AGAAGGTTAA
GATTTCTCAT TGTTATTTTG TATATAATGT TATGCATTGG ATATTTATTG TCTGTTTATT TGTTGAATTC CTGTCGTGAT
GTTTATTTAC ACTATGTTGT CATATGAATT CCAGGCATGT GTTATATGCA AGCAGATGCA TGGTGCCTGC ACTCAGTGCT
ACAAGTGCTC TACTTATTAT CATGCAATGT GTGCATCAAG AGCAGGATAT CGCATGGAGG TAGACTGTGG GAACCCTTTT
CTTGCTTAAA TAAAAAATAA ATTCATTTTG TGACTTACGA GTCTTATGAT GCTTGTCTGG GAGAGTTTTG TGCACTTGTA
CTCGCCCGCT TGGTTTTTGA ATTGATTCTG TGTACTGTTG CTTTGAAGAG CGCAAGCCTT ATGCTTCATT TTTCCATATA
AGCTATTCCA TTGAAGCGTG ACCTGTACAT TTGTTTAAAA TTTATTCTGT ATCATTTGAT GTTAATTTAT TAGTCAATTG
TTTCTTCATT AATGCACAGC TGGATACAGT TTATCATAAT CGATGTTTTT CTGTTGCTTG TAGTTGCAAT ACTCTGAAAA
AAATGGAAGG AACATAACAA GAATGGTTTC CTACTGTGCA TTTCACAGGT AATTTTTTTT CACCTTACTG TCTCACCCTC
TGTTCAAATA TATATCAATT CATCAAATTG TTTCCATTAA AAATAATAGT TCCAATATAG GCTCATGAGT CATGACTCTT
ATTTTCCAGA CCTTGTTCTT TCTTTTTGTT GTTCATCTTA GTAGCATAGC GATACATTCT TTTTTGAGCA AAATCAATAG
TAATCTGATG CATTAAATTG ACAAGATATT GGAACAGTTC TGTTGTCTCA GTTATTTGTG GGAGTGGCAA TTCTACCTTA
AAGGATTAAG TGGCACAAAT TCGTGTTACT TACACCTGTT CTACTGACCC TTTGCAGTAC TCCTGACCCA GATAATGTCT
TGATAGTTAA GACGCCTGAA GGAGTTTTCT CAACCAAATT TTTGCCCCAA AATAATGAGA AACAGAGTGG TACAAGACTT
GTCAGGAAAG AGAATCTACA GGAGAAAGTC CTTCCTGCTA AAATTTCTGA CTGTCCAGCT GCAAGGTGCC TACCTTATGA
AATGCTGAAA AATAAGGTAT TTTATGACGC CCCTATTCTG TTTTGTTCTG TTGCTCCTCC CAAcagtagc agagccagga
attttaccct gtggggtcaa ataccattgc attatatttt agtgggggtc atttttgtaa atttcaatgg acttatatgt
aaaaaaatga gactcacaat ggtatttgca aaaaaagctg tggcgtcagc tgacaataca tggctccgtc actgCCTCCC
AATACAATAA AAGATATAGT TAATTGGCAG GGATAATTCA CGAATTTGTT ACACTGTCCA CTTTCATTTT GTAATTCTTT
GTAGCCCATC CTTTAGACTT TTTATGTTCT TTCTCCTTTT GGTAGTTTCC TTTTTAGTTT ATGTAAAATT CTTAGTTCAT
CCAAGCAATT TAGATTCTTG TCTGCATGGG TTTCTCATGC TGTAATCTAT CCTTGGTTTT GCATGTTCAA AGGATGGGAC
TCTTAGTGGC AGTTATATAC AGTTCTTTTG GAATAATAGG ATGTCTATCA TATGGATGAA TATGGATCTG CCTAGGTTTT
GTTTCTGTTA TAAGCTAGCT CTAGCACTAA ATTTTCTGCA TGTTCCAGAA AGAACCAGGA GAGGCAATTG CCCACAGAAT
AATGGGACCC CGACATCATT CCCAAGAGTC AATTGAGGGT TTGAACGCTT GCATGGTAAC TATCCCATTC TAACTACTGT
ATTGTCTTTC TTCCAGCAAC CATTGAATGC GAGAACTTAT GCATCTTACC CCCACTTGTT AACAGGATCA AAAGGATGAA
AAATCCTTCG CAACTTTTAG AGAACGACTT CGGTATTTAC AGGTTTAGTT TCTGACGGAT TGTTCTTTTT AATATTTGAT
TTCAGCATAC TGATACACTA AATGTTTGAT GATTTCAGAA AATAGAAAAC AAAAGGGTCT CTTGTGGTCG ATCTGGAATA
CATGGATGGG GACTCTTTGC TGCTAAGAAA ATCCAGGAGG GGCAAATGGT ATGCCATTTA AGTTATATGC ATTTTTTCCA
ATAAAACCCA ATAGTTTATC ATGGTAAATA GTTAGCATTC CAGTTCTGTT GTTTGTTGTG CATCCAAATA CTAGGAGCCT
GTTCTTAACA TGTCAATGGA CCACTTTTGT GCTAGGTTAT CGAATATCGC GGTGACCAAG TTAGACGTAG TGTTGCAGAT
TTGAGGGAAG CACGATATCA CAGGGAGAAG AAAGATTGTT ATGTAAGTTG TTCACTGTGT TATTTTGTGG AGGTCATCTG
TTCTACTTTT GACTTGAATT ATTTAGGCAG TTCTACCTGT GAATAATGCA ATGATTTCCA GATAGGTCAC TGATCTACTG
GAAATACCAC ATCTTAACTA TGTGTGATGG TGATGATTCT TTCTTTTGCA CTGCAGCTGT TCAAGATCAG CGAAGACGTT
GTCGTTGATG CAACAGAGAA AGGGAACATA GCCCGCCTAA TTAATCACTC GGTAATACTT TGGGTTTCCC ATTTGCATCT
TCTCTCTACC TTAATAGCCC AACAAAATAT AACAGCTAAA CATTATCGTC ATCGCTTTCA GTGTATGCCT AATTGCTACG
CAAGGATCAT GAGTGTTGGC GATGAAAAGA GCCAGATAAT TCTTATCGCC AAAAGAGACG TCTCCGCTGG CGAAGAACTA
ACGTAATTTG CTCCTTACCC TGCCCTGTCC TGATGCCCCT TTTATACCTT GAGAGTACAG CTAACTGTCT CCATTCCTGA
AGCTATGGAT CTCTACAATT TTCTGATCCG TCTCTCCCTC TTGTGTGCAG CTATGACTAC TTGTTTGACC CTGACGAGTC
CGAGGACTGC AGGGTCCCTT GTCTGTGTAA AGCTCTTAAC TGCCGTGGAT ACATGAACTG AAGTGAACAT TCTCACAAGT
CACAAGGCTA ACCCCCCTTA ACCATGCCAA AGGGCTATAT TCTCAGATTC ATCATGATTC TTTCGTTTAT TCAAAGGCTG
GTTGTCAAAC AAGCATCAAA GTTTGTGATT TTTTTACACA AATTTTGCTA GATAGCGAGG CTGGATTGGA TTTACCGGTT
TCAGACTTTC GGTGAGAGCA TAGCAGGCAC CTGGCAATTT AGCAACACGC TGCCAGAGCC CCTTGTAAAT TCTTCTTACT
TTGATGTAAT AATAAGATGA TTAAGTTGTT AATGCCTTTT CTCCATGATG AAAAGAAAGA GAAATGAATA TCC

Locus: Os01g0218800

Loading...

Locus: Os01g0218800

Loading...