Os01t0218800-02

Locus

Os01g0218800

Description

Similar to SET domain protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET1, SDG721

Oryzabase Gene Name Synonym(s)

SET protein 1

Transcript Evidence

AK103664 (DDBJ, Best hit)

Protein Evidence

XP_002318412.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

PWWP (IPR000313)

SET domain (IPR001214)

Zinc finger, PHD-type (IPR001965)

Post-SET domain (IPR003616)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, PHD-type, conserved site (IPR019786)

Zinc finger, PHD-finger (IPR019787)

Full-length cDNA

J033135J09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0218800-02)

Others

Oryzabase (13370)

Transcript

2747 bp

>Os01t0218800-02 Similar to SET domain protein.
CTGGGTGATGTCGTGTGGGCGAGGTCCGGGAAGAAGTGCCCAGCATGGCCTGCGGTGGTG
ATTGACCCACTGCTCCACGCGCCAGCGGTCGTGTTGAACTCCTGCATCCCGGGTGCACTC
TGCGTCATGTTCTTTGGATTCTCTTCTGGCGGGCATGGCAGGGACTATGGATGGATTAAG
CAAGGGATGATCTTTCCATTTGTGGACTACTTAGACCGGTTTCAGGGTCAGGCTTTGTAT
AAACTCAAGGCAAACAGATTCCGTCAAGCAATTGAGGAGGCTTTCCTTGCTGAGCGTGGG
TTTTGTGAGCTCGAAATGGATGAGGGGTGCTCACTAGAGAAGTCTGTCAATGACCAGTCT
GTCCCTGACGGGTTACAGGAAGGGAGTGGTTCTAACAATGACCAGGAATGTCAATCGGAG
GCTCAGGTTGTTGGCAAATCAACTGGATGTTGTGATAGTTGTGGTAATCGTGTTCCACCC
AAGATCGCGAAGAAAAAGAAGCAAGCGGGAGAGCAGTTACTCTGTAGACACTGTGATAAG
CTATTGCAGTCAAAGCAGTACTGTGGCATATGCAAGAAAATCTGGCACCACACAGATGGT
GGAAATTGGGTTTGTTGTGATGAGTGTCAAATTTGGGTTCACGTAGAATGTGACCTAACA
TGCATCAACATGGAGGACTTAGAAAATGCCGATTACTTCTGTCCAGATTGCAAATCAAAA
CGCAAGACAGTACCTCCTGTTGAACAAATGAACACTCCGAACAGTTCAGAATGTGCTAGC
ACTTCTAAGGAAAAACTGCCGGAAATGATACCTGTGTTCTGCTTTGGGATGGACGGAATG
TATTTACCTAAGAAGCACATGATACTATGCCAATGTAATTCTTGCAAAGAAAGGCTGATG
AGTCTGAGTGAGTGGGAGAGACATACTGGTTCAAGGAAGAAGAACTGGAAGATGAGCGTT
AAACTTAAGAGCAATGGGGATCCATTGGTAACCTTGTTGGATGATATTCCCTGCGCAAAT
GTGAAGTCTTCTACACCAAGTATTAATAAAGAAGAGTTGCTGAAATTGCTAGCAAATTCT
TTTAGACCTGTCAATGCTAGATGGACAACTGAACGTTGTGCTGTTTGTCGATGGGTTGAG
GATTGGGACTACAATAAAATTATTATTTGCAACAGATGCCAAATAGCTGTCCACCAAGAG
TGCTATGGAGCACGTGATGTACAAGATTTTACAAATTGGGTCTGTCGAGCATGTGAATTG
CCGAAACAAAAAAGAGAATGTTGTCTTTGTCCTGTCAAAGGCGGTGCTCTCAAGCCAACA
GATATTGACCAACTATGGGTTCATGTTACATGTGCCTGGTTTCAACCTAAAGTCTCTTTT
CCTGTTGATGAGACAATGGAGCCAGCCATGGGCATATTGAGCATCCCTTCAGAGTACTTT
AAGAAGGCATGTGTTATATGCAAGCAGATGCATGGTGCCTGCACTCAGTGCTACAAGTGC
TCTACTTATTATCATGCAATGTGTGCATCAAGAGCAGGATATCGCATGGAGTTGCAATAC
TCTGAAAAAAATGGAAGGAACATAACAAGAATGGTTTCCTACTGTGCATTTCACAGTACT
CCTGACCCAGATAATGTCTTGATAGTTAAGACGCCTGAAGGAGTTTTCTCAACCAAATTT
TTGCCCCAAAATAATGAGAAACAGAGTGGTACAAGACTTGTCAGGAAAGAGAATCTACAG
GAGAAAGTCCTTCCTGCTAAAATTTCTGACTGTCCAGCTGCAAGGTGCCTACCTTATGAA
ATGCTGAAAAATAAGAAAGAACCAGGAGAGGCAATTGCCCACAGAATAATGGGACCCCGA
CATCATTCCCAAGAGTCAATTGAGGGTTTGAACGCTTGCATGGATCAAAAGGATGAAAAA
TCCTTCGCAACTTTTAGAGAACGACTTCGGTATTTACAGAAAATAGAAAACAAAAGGGTC
TCTTGTGGTCGATCTGGAATACATGGATGGGGACTCTTTGCTGCTAAGAAAATCCAGGAG
GGGCAAATGGTTATCGAATATCGCGGTGACCAAGTTAGACGTAGTGTTGCAGATTTGAGG
GAAGCACGATATCACAGGGAGAAGAAAGATTGTTATCTGTTCAAGATCAGCGAAGACGTT
GTCGTTGATGCAACAGAGAAAGGGAACATAGCCCGCCTAATTAATCACTCGTGTATGCCT
AATTGCTACGCAAGGATCATGAGTGTTGGCGATGAAAAGAGCCAGATAATTCTTATCGCC
AAAAGAGACGTCTCCGCTGGCGAAGAACTAACCTATGACTACTTGTTTGACCCTGACGAG
TCCGAGGACTGCAGGGTCCCTTGTCTGTGTAAAGCTCTTAACTGCCGTGGATACATGAAC
TGAAGTGAACATTCTCACAAGTCACAAGGCTAACCCCCCTTAACCATGCCAAAGGGCTAT
ATTCTCAGATTCATCATGATTCTTTCGTTTATTCAAAGGCTGGTTGTCAAACAAGCATCA
AAGTTTGTGATTTTTTTACACAAATTTTGCTAGATAGCGAGGCTGGATTGGATTTACCGG
TTTCAGACTTTCGGTGAGAGCATAGCAGGCACCTGGCAATTTAGCAACACGCTGCCAGAG
CCCCTTGTAAATTCTTCTTACTTTGATGTAATAATAAGATGATTAAGTTGTTAATGCCTT
TTCTCCATGATGAAAAGAAAGAGAAATGAATATCCAAAATGCATACC

CDS

2403 bp

>Os01t0218800-02 Similar to SET domain protein.
CTGGGTGATGTCGTGTGGGCGAGGTCCGGGAAGAAGTGCCCAGCATGGCCTGCGGTGGTG
ATTGACCCACTGCTCCACGCGCCAGCGGTCGTGTTGAACTCCTGCATCCCGGGTGCACTC
TGCGTCATGTTCTTTGGATTCTCTTCTGGCGGGCATGGCAGGGACTATGGATGGATTAAG
CAAGGGATGATCTTTCCATTTGTGGACTACTTAGACCGGTTTCAGGGTCAGGCTTTGTAT
AAACTCAAGGCAAACAGATTCCGTCAAGCAATTGAGGAGGCTTTCCTTGCTGAGCGTGGG
TTTTGTGAGCTCGAAATGGATGAGGGGTGCTCACTAGAGAAGTCTGTCAATGACCAGTCT
GTCCCTGACGGGTTACAGGAAGGGAGTGGTTCTAACAATGACCAGGAATGTCAATCGGAG
GCTCAGGTTGTTGGCAAATCAACTGGATGTTGTGATAGTTGTGGTAATCGTGTTCCACCC
AAGATCGCGAAGAAAAAGAAGCAAGCGGGAGAGCAGTTACTCTGTAGACACTGTGATAAG
CTATTGCAGTCAAAGCAGTACTGTGGCATATGCAAGAAAATCTGGCACCACACAGATGGT
GGAAATTGGGTTTGTTGTGATGAGTGTCAAATTTGGGTTCACGTAGAATGTGACCTAACA
TGCATCAACATGGAGGACTTAGAAAATGCCGATTACTTCTGTCCAGATTGCAAATCAAAA
CGCAAGACAGTACCTCCTGTTGAACAAATGAACACTCCGAACAGTTCAGAATGTGCTAGC
ACTTCTAAGGAAAAACTGCCGGAAATGATACCTGTGTTCTGCTTTGGGATGGACGGAATG
TATTTACCTAAGAAGCACATGATACTATGCCAATGTAATTCTTGCAAAGAAAGGCTGATG
AGTCTGAGTGAGTGGGAGAGACATACTGGTTCAAGGAAGAAGAACTGGAAGATGAGCGTT
AAACTTAAGAGCAATGGGGATCCATTGGTAACCTTGTTGGATGATATTCCCTGCGCAAAT
GTGAAGTCTTCTACACCAAGTATTAATAAAGAAGAGTTGCTGAAATTGCTAGCAAATTCT
TTTAGACCTGTCAATGCTAGATGGACAACTGAACGTTGTGCTGTTTGTCGATGGGTTGAG
GATTGGGACTACAATAAAATTATTATTTGCAACAGATGCCAAATAGCTGTCCACCAAGAG
TGCTATGGAGCACGTGATGTACAAGATTTTACAAATTGGGTCTGTCGAGCATGTGAATTG
CCGAAACAAAAAAGAGAATGTTGTCTTTGTCCTGTCAAAGGCGGTGCTCTCAAGCCAACA
GATATTGACCAACTATGGGTTCATGTTACATGTGCCTGGTTTCAACCTAAAGTCTCTTTT
CCTGTTGATGAGACAATGGAGCCAGCCATGGGCATATTGAGCATCCCTTCAGAGTACTTT
AAGAAGGCATGTGTTATATGCAAGCAGATGCATGGTGCCTGCACTCAGTGCTACAAGTGC
TCTACTTATTATCATGCAATGTGTGCATCAAGAGCAGGATATCGCATGGAGTTGCAATAC
TCTGAAAAAAATGGAAGGAACATAACAAGAATGGTTTCCTACTGTGCATTTCACAGTACT
CCTGACCCAGATAATGTCTTGATAGTTAAGACGCCTGAAGGAGTTTTCTCAACCAAATTT
TTGCCCCAAAATAATGAGAAACAGAGTGGTACAAGACTTGTCAGGAAAGAGAATCTACAG
GAGAAAGTCCTTCCTGCTAAAATTTCTGACTGTCCAGCTGCAAGGTGCCTACCTTATGAA
ATGCTGAAAAATAAGAAAGAACCAGGAGAGGCAATTGCCCACAGAATAATGGGACCCCGA
CATCATTCCCAAGAGTCAATTGAGGGTTTGAACGCTTGCATGGATCAAAAGGATGAAAAA
TCCTTCGCAACTTTTAGAGAACGACTTCGGTATTTACAGAAAATAGAAAACAAAAGGGTC
TCTTGTGGTCGATCTGGAATACATGGATGGGGACTCTTTGCTGCTAAGAAAATCCAGGAG
GGGCAAATGGTTATCGAATATCGCGGTGACCAAGTTAGACGTAGTGTTGCAGATTTGAGG
GAAGCACGATATCACAGGGAGAAGAAAGATTGTTATCTGTTCAAGATCAGCGAAGACGTT
GTCGTTGATGCAACAGAGAAAGGGAACATAGCCCGCCTAATTAATCACTCGTGTATGCCT
AATTGCTACGCAAGGATCATGAGTGTTGGCGATGAAAAGAGCCAGATAATTCTTATCGCC
AAAAGAGACGTCTCCGCTGGCGAAGAACTAACCTATGACTACTTGTTTGACCCTGACGAG
TCCGAGGACTGCAGGGTCCCTTGTCTGTGTAAAGCTCTTAACTGCCGTGGATACATGAAC
TGA

Protein

801 aa

>Os01t0218800-02 Similar to SET domain protein.
LGDVVWARSGKKCPAWPAVVIDPLLHAPAVVLNSCIPGALCVMFFGFSSGGHGRDYGWIK
QGMIFPFVDYLDRFQGQALYKLKANRFRQAIEEAFLAERGFCELEMDEGCSLEKSVNDQS
VPDGLQEGSGSNNDQECQSEAQVVGKSTGCCDSCGNRVPPKIAKKKKQAGEQLLCRHCDK
LLQSKQYCGICKKIWHHTDGGNWVCCDECQIWVHVECDLTCINMEDLENADYFCPDCKSK
RKTVPPVEQMNTPNSSECASTSKEKLPEMIPVFCFGMDGMYLPKKHMILCQCNSCKERLM
SLSEWERHTGSRKKNWKMSVKLKSNGDPLVTLLDDIPCANVKSSTPSINKEELLKLLANS
FRPVNARWTTERCAVCRWVEDWDYNKIIICNRCQIAVHQECYGARDVQDFTNWVCRACEL
PKQKRECCLCPVKGGALKPTDIDQLWVHVTCAWFQPKVSFPVDETMEPAMGILSIPSEYF
KKACVICKQMHGACTQCYKCSTYYHAMCASRAGYRMELQYSEKNGRNITRMVSYCAFHST
PDPDNVLIVKTPEGVFSTKFLPQNNEKQSGTRLVRKENLQEKVLPAKISDCPAARCLPYE
MLKNKKEPGEAIAHRIMGPRHHSQESIEGLNACMDQKDEKSFATFRERLRYLQKIENKRV
SCGRSGIHGWGLFAAKKIQEGQMVIEYRGDQVRRSVADLREARYHREKKDCYLFKISEDV
VVDATEKGNIARLINHSCMPNCYARIMSVGDEKSQIILIAKRDVSAGEELTYDYLFDPDE
SEDCRVPCLCKALNCRGYMN*

CDS

chr01:6513818..6513979 (- strand) : 162 bp

chr01:6513545..6513600 (- strand) : 56 bp

chr01:6513241..6513448 (- strand) : 208 bp

chr01:6513034..6513147 (- strand) : 114 bp

chr01:6512868..6512936 (- strand) : 69 bp

chr01:6512698..6512763 (- strand) : 66 bp

chr01:6512484..6512578 (- strand) : 95 bp

chr01:6512298..6512387 (- strand) : 90 bp

chr01:6511734..6511869 (- strand) : 136 bp

chr01:6511521..6511596 (- strand) : 76 bp

chr01:6511335..6511437 (- strand) : 103 bp

chr01:6511100..6511224 (- strand) : 125 bp

chr01:6510726..6510871 (- strand) : 146 bp

chr01:6510502..6510606 (- strand) : 105 bp

chr01:6510113..6510177 (- strand) : 65 bp

chr01:6509585..6509783 (- strand) : 199 bp

chr01:6508906..6508992 (- strand) : 87 bp

chr01:6508759..6508815 (- strand) : 57 bp

chr01:6508593..6508682 (- strand) : 90 bp

chr01:6508359..6508445 (- strand) : 87 bp

chr01:6508110..6508184 (- strand) : 75 bp

chr01:6507919..6508019 (- strand) : 101 bp

chr01:6507700..6507790 (- strand) : 91 bp

3'UTR

chr01:6507356..6507699 (- strand) : 344 bp

FASTA

>Os01t0218800-02 class=Sequence position=chr01:6507356..6513979 (- strand)
CTGGGTGATG TCGTGTGGGC GAGGTCCGGG AAGAAGTGCC CAGCATGGCC TGCGGTGGTG ATTGACCCAC TGCTCCACGC
GCCAGCGGTC GTGTTGAACT CCTGCATCCC GGGTGCACTC TGCGTCATGT TCTTTGGATT CTCTTCTGGC GGGCATGGCA
GGGTAAGCTT TGTGGGGTGT TGGTTTTTGT TTTGTCCTTG AAATCCACAA CCCAACATTT AAATGTGATT TTTTTTTTGA
ATTTAAATGT GGAATAAGAG TTCCACGAAG TGCAACTGAA ACAGGGTAAA CCATGTGTCG CATGGGCCAA ACAGTCCCTT
TCTGTTTTTT TTTTTTTGGT TTGCGTCAAC TTACAGTACT GTATTTCTTT GCATCGCAGG ACTATGGATG GATTAAGCAA
GGGATGATCT TTCCATTTGT GGACTACTTA GACCGGTAAG CTACTGGCAT ACGTTCGTTT TTTTTTAAAA AAAATGCTGC
TATGGGGATT TATTTACCTG CGTGCTATCT GAAATTTCTT TGGTCTCCCA GGTTTCAGGG TCAGGCTTTG TATAAACTCA
AGGCAAACAG ATTCCGTCAA GCAATTGAGG AGGCTTTCCT TGCTGAGCGT GGGTTTTGTG AGCTCGAAAT GGATGAGGGG
TGCTCACTAG AGAAGTCTGT CAATGACCAG TCTGTCCCTG ACGGGTTACA GGAAGGGAGT GGTTCTAACA ATGACCAGGA
ATGTCAATCG GAGGCTCAGG TAAGTTCCGG ATGCATCACA AATGTAAAGA TATGAGCTTG TGACTGCCTT ATTACAACTT
TCAGCTGAGC CGCAATCTAA TCAACACTGC AGGTTGTTGG CAAATCAACT GGATGTTGTG ATAGTTGTGG TAATCGTGTT
CCACCCAAGA TCGCGAAGAA AAAGAAGCAA GCGGGAGAGC AGTTACTCTG TAGACACTGT GATAAGGTAT GCGGCCGTAC
ATTTGAGATG GGTTTTTGTG TGTTCCATTA CTGTTTTCTG TTTTTATGGT GCCTTATGTG TGCAAATTTT ATTATATCTG
CAGCTATTGC AGTCAAAGCA GTACTGTGGC ATATGCAAGA AAATCTGGCA CCACACAGAT GGTGGAAATT GGGTAAGAGC
TTAGAAATAT ATGTGTTTCG TCGCTGTTAT ATTCTACATG TTCTCTTGAT TTGTCCATGG GTCAAGGCTC ACAACCTGCA
ACACCCTTCT TTGCAGGTTT GTTGTGATGA GTGTCAAATT TGGGTTCACG TAGAATGTGA CCTAACATGC ATCAACATGG
AGGTAATCTG CTTCTTTTGT TTTGATGTTT ATATTTTTTA TCCTATTGTT TGACACAGAT ATCGAACAGT TCTACGAATA
ATAACTGTAT ATAATTTGCT GACTCCAGTA CTGTTTTATA GGACTTAGAA AATGCCGATT ACTTCTGTCC AGATTGCAAA
TCAAAACGCA AGACAGTACC TCCTGTTGAA CAAATGAACA CTCCGAACAG TTCAGAGTGA GTTATTTAAT TTTTTCATCC
AACCTATTGA CTTCTATTTA ACGTTACTCA AATGATTATA AGCATGCCAC TTTCTAATGT ATCTATACAC AGATGTGCTA
GCACTTCTAA GGAAAAACTG CCGGAAATGA TACCTGTGTT CTGCTTTGGG ATGGACGGAA TGTATTTACC TAAGAAGCAC
ATGTATGTAT TCTGCATATC TTCTATTTAA TCTACAGCCA GCATGCTTCT TTAAGCTTAT TACATGGATA TCAATACTCT
TTAAGTGATT TTAGCGTGTT TTATTTCTCA ATCCCCCATA TCATGTAGAG TCATATGTTC TTTGAAGGAC TACTAGATTT
AGGTGATAGG TTATTTTCCT AGGGGCATAT ATTTCTCTTT TGTTTCATTC ATCTGGCATG AAAATTGACA CTTAACCAAT
TTAGCCATAT TGGATATTTT GTGCCACAAG GCTTAGAAGG CTCAATAAGA AAAACAACAT TTGAAAGGTC GATTGTTCAA
TATTAAAGAA ATTCATGTAT TCCTTTCTTT CTAAAGGACT ATAAACTGAT TTCCTGATGT GGCTGTGGCT GGTGCAACTG
TTGGTATTGA CTTTGTATTG TTATTGGCAG GATACTATGC CAATGTAATT CTTGCAAAGA AAGGCTGATG AGTCTGAGTG
AGTGGGAGAG ACATACTGGT TCAAGGAAGA AGAACTGGAA GATGAGCGTT AAACTTAAGA GCAATGGGGA TCCATTGGTA
ACCTTGGTAA GCCTTTAAGA TCTTCATTTA TCTGAAAGTT GGTGGTCTAT AATGATCGCT AAACTTGAAT TCACCTAGTT
TTCAATAAAA TTCAAAGGTA TGAGAACTTG ATATGACTTC TTTCATGTTT GTCTGACCTT CAGTTGGATG ATATTCCCTG
CGCAAATGTG AAGTCTTCTA CACCAAGTAT TAATAAAGAA GAGTTGCTGA AATTGCTAGG TACATTGGCT CTTGAGTTTA
TGTTGGTTTC TGCAGTTGGT GTGTGCAACT TGTTTCACAA CAAATGAATT TGATGCTTGC AGCAAATTCT TTTAGACCTG
TCAATGCTAG ATGGACAACT GAACGTTGTG CTGTTTGTCG ATGGGTTGAG GATTGGGACT ACAATAAAAT TATTATTTGC
AACAGGTATT TCCTGCTAAT CTTTGAGGTT TTTTTGACAC CCTTAGTTTA TGGATTCATT ATATGTTTTA GGACTGCGTG
TAGCTGAAAA ACTTGTCCAA AATCTTTATG TGCAGATGCC AAATAGCTGT CCACCAAGAG TGCTATGGAG CACGTGATGT
ACAAGATTTT ACAAATTGGG TCTGTCGAGC ATGTGAATTG CCGAAACAAA AAAGAGAATG TTGTCTTTGT CCTGTCAAAG
GTATCATTCC TGCCATGATG TTGTATGTCA TCACAGTATT GAATGATACT GATACCTCAC ATTTTTTTCT GAGGCTTTCC
AGTGTTCCTT ATATTATGTT TATATGATGT ACCCCATTTG ATTAAATTGC AGTGGTGCTT GGTGTCCATT TTTCCTAGTC
TTGGTTCGCT GCATTATATT ATTTTTTAAT GCTATCAGTA TTCACCTTTT CTTTTTTAAT TGCTTTAGGC GGTGCTCTCA
AGCCAACAGA TATTGACCAA CTATGGGTTC ATGTTACATG TGCCTGGTTT CAACCTAAAG TCTCTTTTCC TGTTGATGAG
ACAATGGAGC CAGCCATGGG CATATTGAGC ATCCCTTCAG AGTACTTTAA GAAGGTTAAG ATTTCTCATT GTTATTTTGT
ATATAATGTT ATGCATTGGA TATTTATTGT CTGTTTATTT GTTGAATTCC TGTCGTGATG TTTATTTACA CTATGTTGTC
ATATGAATTC CAGGCATGTG TTATATGCAA GCAGATGCAT GGTGCCTGCA CTCAGTGCTA CAAGTGCTCT ACTTATTATC
ATGCAATGTG TGCATCAAGA GCAGGATATC GCATGGAGGT AGACTGTGGG AACCCTTTTC TTGCTTAAAT AAAAAATAAA
TTCATTTTGT GACTTACGAG TCTTATGATG CTTGTCTGGG AGAGTTTTGT GCACTTGTAC TCGCCCGCTT GGTTTTTGAA
TTGATTCTGT GTACTGTTGC TTTGAAGAGC GCAAGCCTTA TGCTTCATTT TTCCATATAA GCTATTCCAT TGAAGCGTGA
CCTGTACATT TGTTTAAAAT TTATTCTGTA TCATTTGATG TTAATTTATT AGTCAATTGT TTCTTCATTA ATGCACAGCT
GGATACAGTT TATCATAATC GATGTTTTTC TGTTGCTTGT AGTTGCAATA CTCTGAAAAA AATGGAAGGA ACATAACAAG
AATGGTTTCC TACTGTGCAT TTCACAGGTA ATTTTTTTTC ACCTTACTGT CTCACCCTCT GTTCAAATAT ATATCAATTC
ATCAAATTGT TTCCATTAAA AATAATAGTT CCAATATAGG CTCATGAGTC ATGACTCTTA TTTTCCAGAC CTTGTTCTTT
CTTTTTGTTG TTCATCTTAG TAGCATAGCG ATACATTCTT TTTTGAGCAA AATCAATAGT AATCTGATGC ATTAAATTGA
CAAGATATTG GAACAGTTCT GTTGTCTCAG TTATTTGTGG GAGTGGCAAT TCTACCTTAA AGGATTAAGT GGCACAAATT
CGTGTTACTT ACACCTGTTC TACTGACCCT TTGCAGTACT CCTGACCCAG ATAATGTCTT GATAGTTAAG ACGCCTGAAG
GAGTTTTCTC AACCAAATTT TTGCCCCAAA ATAATGAGAA ACAGAGTGGT ACAAGACTTG TCAGGAAAGA GAATCTACAG
GAGAAAGTCC TTCCTGCTAA AATTTCTGAC TGTCCAGCTG CAAGGTGCCT ACCTTATGAA ATGCTGAAAA ATAAGGTATT
TTATGACGCC CCTATTCTGT TTTGTTCTGT TGCTCCTCCC AAcagtagca gagccaggaa ttttaccctg tggggtcaaa
taccattgca ttatatttta gtgggggtca tttttgtaaa tttcaatgga cttatatgta aaaaaatgag actcacaatg
gtatttgcaa aaaaagctgt ggcgtcagct gacaatacat ggctccgtca ctgCCTCCCA ATACAATAAA AGATATAGTT
AATTGGCAGG GATAATTCAC GAATTTGTTA CACTGTCCAC TTTCATTTTG TAATTCTTTG TAGCCCATCC TTTAGACTTT
TTATGTTCTT TCTCCTTTTG GTAGTTTCCT TTTTAGTTTA TGTAAAATTC TTAGTTCATC CAAGCAATTT AGATTCTTGT
CTGCATGGGT TTCTCATGCT GTAATCTATC CTTGGTTTTG CATGTTCAAA GGATGGGACT CTTAGTGGCA GTTATATACA
GTTCTTTTGG AATAATAGGA TGTCTATCAT ATGGATGAAT ATGGATCTGC CTAGGTTTTG TTTCTGTTAT AAGCTAGCTC
TAGCACTAAA TTTTCTGCAT GTTCCAGAAA GAACCAGGAG AGGCAATTGC CCACAGAATA ATGGGACCCC GACATCATTC
CCAAGAGTCA ATTGAGGGTT TGAACGCTTG CATGGTAACT ATCCCATTCT AACTACTGTA TTGTCTTTCT TCCAGCAACC
ATTGAATGCG AGAACTTATG CATCTTACCC CCACTTGTTA ACAGGATCAA AAGGATGAAA AATCCTTCGC AACTTTTAGA
GAACGACTTC GGTATTTACA GGTTTAGTTT CTGACGGATT GTTCTTTTTA ATATTTGATT TCAGCATACT GATACACTAA
ATGTTTGATG ATTTCAGAAA ATAGAAAACA AAAGGGTCTC TTGTGGTCGA TCTGGAATAC ATGGATGGGG ACTCTTTGCT
GCTAAGAAAA TCCAGGAGGG GCAAATGGTA TGCCATTTAA GTTATATGCA TTTTTTCCAA TAAAACCCAA TAGTTTATCA
TGGTAAATAG TTAGCATTCC AGTTCTGTTG TTTGTTGTGC ATCCAAATAC TAGGAGCCTG TTCTTAACAT GTCAATGGAC
CACTTTTGTG CTAGGTTATC GAATATCGCG GTGACCAAGT TAGACGTAGT GTTGCAGATT TGAGGGAAGC ACGATATCAC
AGGGAGAAGA AAGATTGTTA TGTAAGTTGT TCACTGTGTT ATTTTGTGGA GGTCATCTGT TCTACTTTTG ACTTGAATTA
TTTAGGCAGT TCTACCTGTG AATAATGCAA TGATTTCCAG ATAGGTCACT GATCTACTGG AAATACCACA TCTTAACTAT
GTGTGATGGT GATGATTCTT TCTTTTGCAC TGCAGCTGTT CAAGATCAGC GAAGACGTTG TCGTTGATGC AACAGAGAAA
GGGAACATAG CCCGCCTAAT TAATCACTCG GTAATACTTT GGGTTTCCCA TTTGCATCTT CTCTCTACCT TAATAGCCCA
ACAAAATATA ACAGCTAAAC ATTATCGTCA TCGCTTTCAG TGTATGCCTA ATTGCTACGC AAGGATCATG AGTGTTGGCG
ATGAAAAGAG CCAGATAATT CTTATCGCCA AAAGAGACGT CTCCGCTGGC GAAGAACTAA CGTAATTTGC TCCTTACCCT
GCCCTGTCCT GATGCCCCTT TTATACCTTG AGAGTACAGC TAACTGTCTC CATTCCTGAA GCTATGGATC TCTACAATTT
TCTGATCCGT CTCTCCCTCT TGTGTGCAGC TATGACTACT TGTTTGACCC TGACGAGTCC GAGGACTGCA GGGTCCCTTG
TCTGTGTAAA GCTCTTAACT GCCGTGGATA CATGAACTGA AGTGAACATT CTCACAAGTC ACAAGGCTAA CCCCCCTTAA
CCATGCCAAA GGGCTATATT CTCAGATTCA TCATGATTCT TTCGTTTATT CAAAGGCTGG TTGTCAAACA AGCATCAAAG
TTTGTGATTT TTTTACACAA ATTTTGCTAG ATAGCGAGGC TGGATTGGAT TTACCGGTTT CAGACTTTCG GTGAGAGCAT
AGCAGGCACC TGGCAATTTA GCAACACGCT GCCAGAGCCC CTTGTAAATT CTTCTTACTT TGATGTAATA ATAAGATGAT
TAAGTTGTTA ATGCCTTTTC TCCATGATGA AAAGAAAGAG AAATGAATAT CCAAAATGCA TACC

Locus: Os01g0218800

Loading...

Locus: Os01g0218800

Loading...