Os01t0219500-01

Locus

Os01g0219500

Description

Plant lipid transfer protein/Par allergen family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.1, T42, OsLtp1.1, LTP1.1

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.1, lipid transfer protein 1.1, type 1 non-specific lipid transfer protein 1

Transcript Evidence

AK109524 (DDBJ, Best hit)

AK106863 (DDBJ, Best hit)

Protein Evidence

GeneMark

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

002-115-F10 (Online Clone Ordering)

002-118-C09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0219500-01)

Others

Oryzabase (13510)

Transcript

1966 bp

>Os01t0219500-01 Plant lipid transfer protein/Par allergen family protein.
AGCAACTCCCCTCCTCCACTAGACCACCATGCACAGATCGATGGCCTCTCAGGCGGTGGC
GCCCCTCCTCCTCATCCTCATGCTCGCGGCGGCGGCGGGGGGCGCGTCGGCGGCGGTGCA
GTGCGGGCAGGTGATGCAGCTGATGGCGCCGTGCATGCCGTAcctcgccggcgcccccgg
gatgacgccctacggcatctgctgcgacagcctcggcgtgctcaaccggatggccccggc
ccccgccgaccgcgtcgccgtctgcaactgcgtcaaggacgccgccgccggcttccccgc
cgtcgacttctcccgcgcctccgccctccccgccgcctgcggcctctccATCAGCTTCAC
CATCGCCCCCAACATGGACTGCAACCAGGTTACAGAGGAACTGAGAATCTGAGAGCGTGA
GGAATCGAGTTCATGTTGCATTTATCATCAATCATCATCGACTAGATCAATAAATCGAGC
AAAGCTTTGATAAAGAGCGAGCCGCCTTAATTAATTTACAATAATCTTGGATGTCATCCT
GCATGCGTGTATGATCACACGGTTGTTTAATTAGGCACTTTAATTTTGCACTGTCGTGTG
TTACTTATTCCTGATCTCTACTATACGGTGACTAACCCCTGATCAAAAGtttaattcaac
atgttttcgagtacttgcgatcctaattcccaaattcatatgctttgcaatatcaaatga
tccatcgagaagaagaaactatatattattccaaaaacgataacccaaacgagctttgca
atatattattcataatatgctttgcaatatcaaacgatccatcttgaatcagcaatggtt
gttcgttgcacgtcccaatttcagacgagcttgtagccgatgacccagaCGTCAGCCGGC
GGCGGCGCGGCGCGGCCGCGGACAACGTAGGCGAAGGCGGCGCTCTCGCCGGCGGCCAGC
GACGACGGGAGCACGTAGCCGTACCTCGCCGCCTTCTCGAGCCCCCACACCGGGCCGTGC
GGCTTGCCGATGCCGATGTGGAGCTCCTCGACCGTCTTGCCGCCGGCCGGCGACCTGTTG
CTCACCGTCGCCGCGTACCGGCGGTACGTCCTCCCGTCCTTCTTCCACGACGCCGTCGCG
TTCAGCTGCGTGATCTCCACCGGCGACGCCGCAGCTGCGAGAGGTGGCAGCAAGGTCTGG
TTGTCCGGCCTCTTGATCGCTGCTTCGGCGAGCCCGCCGCGGCCGCCGCCGGCGAGGCGA
GCGAGGACGCCCATGAGCGGCGCGTTGTTGTAGGTGGCCACCTCCGTCTGCTGGTAGTTG
TTCCTCTCGTCGGCGAAGCCGTCGCGCCCGTCGGGGCCGCCGACCACGGCGCCGTCGAGC
AGGTTCGGGTTGCTGCCGGCGCGGCCGAACCAGCTCGCGTACCCATCCTTGCAGCTCACG
AACGACGGGTTGGCCCTGATGGAGACGATGGACGCGCCGCGGTGGTGCGCGCGCCGCGGG
TACCTCGCGCCATAGCCGACCATGTAGCTAATCCCCCTCGGGTTGCTACCCAGGATGTAG
TCCACCTGCGACTTGGCCAGCGCGACGAGCTCCGACGCCCGCGCCGCCGGCCCGGCCTGG
CACCGCACGACGGCTTGCCCGCGGCCGGCGGCGGCGAGGTGGTCGGCGTAGACGGCCAGC
AGGAACGACGCGCCGGTGACGAACTGGAGGTTGTTCCAGCCCTGGTGGTACATCAGGCCG
CCGGGCGTCCTCCCGACGTTGCCACCGCCGCCGCCCTTGCCGAGGCAGGAGCACGCGAAG
ACGTCGGCGTTCCGCTGGTACCTCCGCAGCACGGCGGCGTGCGGCCCGGCCTTCCCTTGC
AGGAGAAACTACATCAAAAGGAATGTAAGTATAAGTACAGTGTTGGGGTGAGTAGTACTA
CTCTTGTATCCGACAAAATGTGGTAATCACTGTAGCATTTCAGACC

CDS

384 bp

>Os01t0219500-01 Plant lipid transfer protein/Par allergen family protein.
ATGCACAGATCGATGGCCTCTCAGGCGGTGGCGCCCCTCCTCCTCATCCTCATGCTCGCG
GCGGCGGCGGGGGGCGCGTCGGCGGCGGTGCAGTGCGGGCAGGTGATGCAGCTGATGGCG
CCGTGCATGCCGTAcctcgccggcgcccccgggatgacgccctacggcatctgctgcgac
agcctcggcgtgctcaaccggatggccccggcccccgccgaccgcgtcgccgtctgcaac
tgcgtcaaggacgccgccgccggcttccccgccgtcgacttctcccgcgcctccgccctc
cccgccgcctgcggcctctccATCAGCTTCACCATCGCCCCCAACATGGACTGCAACCAG
GTTACAGAGGAACTGAGAATCTGA

Protein

128 aa

>Os01t0219500-01 Plant lipid transfer protein/Par allergen family protein.
MHRSMASQAVAPLLLILMLAAAAGGASAAVQCGQVMQLMAPCMPYLAGAPGMTPYGICCD
SLGVLNRMAPAPADRVAVCNCVKDAAAGFPAVDFSRASALPAACGLSISFTIAPNMDCNQ
VTEELRI*

5'UTR

chr01:6541008..6541035 (+ strand) : 28 bp

CDS

chr01:6541036..6541394 (+ strand) : 359 bp

chr01:6541498..6541522 (+ strand) : 25 bp

3'UTR

chr01:6541523..6543076 (+ strand) : 1554 bp

FASTA

>Os01t0219500-01 class=Sequence position=chr01:6541008..6543076 (+ strand)
AGCAACTCCC CTCCTCCACT AGACCACCAT GCACAGATCG ATGGCCTCTC AGGCGGTGGC GCCCCTCCTC CTCATCCTCA
TGCTCGCGGC GGCGGCGGGG GGCGCGTCGG CGGCGGTGCA GTGCGGGCAG GTGATGCAGC TGATGGCGCC GTGCATGCCG
TAcctcgccg gcgcccccgg gatgacgccc tacggcatct gctgcgacag cctcggcgtg ctcaaccgga tggccccggc
ccccgccgac cgcgtcgccg tctgcaactg cgtcaaggac gccgccgccg gcttccccgc cgtcgacttc tcccgcgcct
ccgccctccc cgccgcctgc ggcctctccA TCAGCTTCAC CATCGCCCCC AACATGGACT GCAACCAGTA AGTTCATTCA
TTCTTTCTTA ACTCCAATTC AATTTATCCA TCACCTCGAC TTAAGCCTGA TTAAACTTAA CTTGTTCTTT GCATGCTTGC
ACTATTGCAG GGTTACAGAG GAACTGAGAA TCTGAGAGCG TGAGGAATCG AGTTCATGTT GCATTTATCA TCAATCATCA
TCGACTAGAT CAATAAATCG AGCAAAGCTT TGATAAAGAG CGAGCCGCCT TAATTAATTT ACAATAATCT TGGATGTCAT
CCTGCATGCG TGTATGATCA CACGGTTGTT TAATTAGGCA CTTTAATTTT GCACTGTCGT GTGTTACTTA TTCCTGATCT
CTACTATACG GTGACTAACC CCTGATCAAA AGtttaattc aacatgtttt cgagtacttg cgatcctaat tcccaaattc
atatgctttg caatatcaaa tgatccatcg agaagaagaa actatatatt attccaaaaa cgataaccca aacgagcttt
gcaatatatt attcataata tgctttgcaa tatcaaacga tccatcttga atcagcaatg gttgttcgtt gcacgtccca
atttcagacg agcttgtagc cgatgaccca gaCGTCAGCC GGCGGCGGCG CGGCGCGGCC GCGGACAACG TAGGCGAAGG
CGGCGCTCTC GCCGGCGGCC AGCGACGACG GGAGCACGTA GCCGTACCTC GCCGCCTTCT CGAGCCCCCA CACCGGGCCG
TGCGGCTTGC CGATGCCGAT GTGGAGCTCC TCGACCGTCT TGCCGCCGGC CGGCGACCTG TTGCTCACCG TCGCCGCGTA
CCGGCGGTAC GTCCTCCCGT CCTTCTTCCA CGACGCCGTC GCGTTCAGCT GCGTGATCTC CACCGGCGAC GCCGCAGCTG
CGAGAGGTGG CAGCAAGGTC TGGTTGTCCG GCCTCTTGAT CGCTGCTTCG GCGAGCCCGC CGCGGCCGCC GCCGGCGAGG
CGAGCGAGGA CGCCCATGAG CGGCGCGTTG TTGTAGGTGG CCACCTCCGT CTGCTGGTAG TTGTTCCTCT CGTCGGCGAA
GCCGTCGCGC CCGTCGGGGC CGCCGACCAC GGCGCCGTCG AGCAGGTTCG GGTTGCTGCC GGCGCGGCCG AACCAGCTCG
CGTACCCATC CTTGCAGCTC ACGAACGACG GGTTGGCCCT GATGGAGACG ATGGACGCGC CGCGGTGGTG CGCGCGCCGC
GGGTACCTCG CGCCATAGCC GACCATGTAG CTAATCCCCC TCGGGTTGCT ACCCAGGATG TAGTCCACCT GCGACTTGGC
CAGCGCGACG AGCTCCGACG CCCGCGCCGC CGGCCCGGCC TGGCACCGCA CGACGGCTTG CCCGCGGCCG GCGGCGGCGA
GGTGGTCGGC GTAGACGGCC AGCAGGAACG ACGCGCCGGT GACGAACTGG AGGTTGTTCC AGCCCTGGTG GTACATCAGG
CCGCCGGGCG TCCTCCCGAC GTTGCCACCG CCGCCGCCCT TGCCGAGGCA GGAGCACGCG AAGACGTCGG CGTTCCGCTG
GTACCTCCGC AGCACGGCGG CGTGCGGCCC GGCCTTCCCT TGCAGGAGAA ACTACATCAA AAGGAATGTA AGTATAAGTA
CAGTGTTGGG GTGAGTAGTA CTACTCTTGT ATCCGACAAA ATGTGGTAAT CACTGTAGCA TTTCAGACC

Locus: Os01g0219500

Loading...

Locus: Os01g0219500

Loading...