Os01t0219600-00

Locus

Os01g0219600

Description

Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GH9C2

CGSNL Gene Name

GLYCOSIDE HYDROLASE 9C2

Oryzabase Gene Symbol Synonym(s)

OsGH9C2

Oryzabase Gene Name Synonym(s)

glycoside hydrolase OsGH9C2, glycoside hydrolase 9C2

Transcript Evidence

Q5NAT8 (UniProt)

Protein Evidence

Q5NAT8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Cellular Component: extracellular region (GO:0005576)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: carbohydrate binding (GO:0030246)

Functional domain (InterPro)

Glycoside hydrolase, family 9 (IPR001701)

Six-hairpin glycosidase-like (IPR008928)

Six-hairpin glycosidase (IPR012341)

Glycoside hydrolase, family 9, active site (IPR018221)

Carbohydrate binding domain CBM49 (IPR019028)

Expression Databases

TENOR (Os01t0219600-00)

Others

Oryzabase (11720)

Transcript

1923 bp

>Os01t0219600-00 Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).
ATGGCCAGGAGAGGAGGAGCAGCAGCATCGTCGTCCATGGCTAATCTCCTCGGCGTCGCC
TTGGTGCTCGCCGCCACGGCGCAGACGTCGGCGCGTGGCGGCGGCGGCGGCGGACGCCAT
GACTACCGCATGGCGCTGAGCAAGAGCATCCTCTACTTCGAGGCGCAGCGCTCCGGCGTG
CTCCCCGGTAACCAGAGGATCGCATGGAGGGCCAACTCCGGCCTCGCCGACGGCAAGGCC
AACGGCGTGGATCTTGTTGGTGGCTACTACGACGCCGGAGACAACGTCAAGTTCGGGTTC
CCGATGGCGTTCACGGTGACCATGATGGCGTGGAGCGTCCTCGAGTACGGGAAGCAGATG
GCGGCCGCCGGCGAGCTCGGCCACGCCATGGACGCCGTCAGGTGGGGCGCCGACTACTTC
GTCAAGGCGCACCCGGCGCCCAACGTGCTCTACGGCGAGGTTGGAGATGGTGACTCGGAC
CACGTCTGCTGGCAGCGGCCGGAGGACATGACGACGAGCCGTCAGGCGTATCGCCTTGAC
CCTCAGCATCCTGGCTCTGACCTCGCCGGAGAAACCGCCACGGCATTGGCCGCCGCGTCG
CTCGTCTTCCGTAGCTCCAACCCGGGCTACGCAAACCAACTCCTGCAACACTCCAAGCAG
CTGTTTGATTTCGCCGACAAGTACCGGGGAAAGTACGACGACAGCATGCCTGTCGTGAAG
AAATTTTACGGGTCATTCAGCGGATACGGGGATGAACTACTGTGGGCATCGGCATGGCTA
TACCAGGCGACCGACAACCGCCGCTACCTAGATTACTTGGCCAACAATGGTGACGCACTC
GGCGGGACCGGTTGGGCTACCAACGAATTCGGCTGGGACGTCAAGTACCCCGGAGTGCAA
GTCCTAGCTGCAAAGTTTCTCCTGCAAGGGAAGGCCGGGCCGCACGCCGCCGTGCTGCGG
AGGTACCAGCGGAACGCCGACGTCTTCGCGTGCTCCTGCCTCGGCAAGGGCGGCGGCGGT
GGCAACGTCGGGAGGACGCCCGGCGGCCTGATGTACCACCAGGGCTGGAACAACCTCCAG
TTCGTCACCGGCGCGTCGTTCCTGCTGGCCGTCTACGCCGACCACCTCGCCGCCGCCGGC
CGCGGGCAAGCCGTCGTGCGGTGCCAGGCCGGGCCGGCGGCGCGGGCGTCGGAGCTCGTC
GCGCTGGCCAAGTCGCAGGTGGACTACATCCTGGGTAGCAACCCGAGGGGGATTAGCTAC
ATGGTCGGCTATGGCGCGAGGTACCCGCGGCGCGCGCACCACCGCGGCGCGTCCATCGTC
TCCATCAGGGCCAACCCGTCGTTCGTGAGCTGCAAGGATGGGTACGCGAGCTGGTTCGGC
CGCGCCGGCAGCAACCCGAACCTGCTCGACGGCGCCGTGGTCGGCGGCCCCGACGGGCGC
GACGGCTTCGCCGACGAGAGGAACAACTACCAGCAGACGGAGGTGGCCACCTACAACAAC
GCGCCGCTCATGGGCGTCCTCGCTCGCCTCGCCGGCGGCGGCCGCGGCGGGCTCGCCGAA
GCAGCGATCAAGAGGCCGGACAACCAGACCTTGCTGCCACCTCTCGCAGCTGCGGCGTCG
CCGGTGGAGATCACGCAGCTGAACGCGACGGCGTCGTGGAAGAAGGACGGGAGGACGTAC
CGCCGGTACGCGGCGACGGTGAGCAACAGGTCGCCGGCCGGCGGCAAGACGGTCGAGGAG
CTCCACATCGGCATCGGCAAGCCGCACGGCCCGGTGTGGGGGCTCGAGAAGGCGGCGAGG
TACGGCTACGTGCTCCCGTCGTCGCTGGCCGCCGGCGAGAGCGCCGCCTTCGCCTACGTT
GTCCGCGGCCGCGCCGCGCCGCCGCCGGCTGACGtctgggtcatcggctacaagctcgtc
tga

CDS

1923 bp

>Os01t0219600-00 Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).
ATGGCCAGGAGAGGAGGAGCAGCAGCATCGTCGTCCATGGCTAATCTCCTCGGCGTCGCC
TTGGTGCTCGCCGCCACGGCGCAGACGTCGGCGCGTGGCGGCGGCGGCGGCGGACGCCAT
GACTACCGCATGGCGCTGAGCAAGAGCATCCTCTACTTCGAGGCGCAGCGCTCCGGCGTG
CTCCCCGGTAACCAGAGGATCGCATGGAGGGCCAACTCCGGCCTCGCCGACGGCAAGGCC
AACGGCGTGGATCTTGTTGGTGGCTACTACGACGCCGGAGACAACGTCAAGTTCGGGTTC
CCGATGGCGTTCACGGTGACCATGATGGCGTGGAGCGTCCTCGAGTACGGGAAGCAGATG
GCGGCCGCCGGCGAGCTCGGCCACGCCATGGACGCCGTCAGGTGGGGCGCCGACTACTTC
GTCAAGGCGCACCCGGCGCCCAACGTGCTCTACGGCGAGGTTGGAGATGGTGACTCGGAC
CACGTCTGCTGGCAGCGGCCGGAGGACATGACGACGAGCCGTCAGGCGTATCGCCTTGAC
CCTCAGCATCCTGGCTCTGACCTCGCCGGAGAAACCGCCACGGCATTGGCCGCCGCGTCG
CTCGTCTTCCGTAGCTCCAACCCGGGCTACGCAAACCAACTCCTGCAACACTCCAAGCAG
CTGTTTGATTTCGCCGACAAGTACCGGGGAAAGTACGACGACAGCATGCCTGTCGTGAAG
AAATTTTACGGGTCATTCAGCGGATACGGGGATGAACTACTGTGGGCATCGGCATGGCTA
TACCAGGCGACCGACAACCGCCGCTACCTAGATTACTTGGCCAACAATGGTGACGCACTC
GGCGGGACCGGTTGGGCTACCAACGAATTCGGCTGGGACGTCAAGTACCCCGGAGTGCAA
GTCCTAGCTGCAAAGTTTCTCCTGCAAGGGAAGGCCGGGCCGCACGCCGCCGTGCTGCGG
AGGTACCAGCGGAACGCCGACGTCTTCGCGTGCTCCTGCCTCGGCAAGGGCGGCGGCGGT
GGCAACGTCGGGAGGACGCCCGGCGGCCTGATGTACCACCAGGGCTGGAACAACCTCCAG
TTCGTCACCGGCGCGTCGTTCCTGCTGGCCGTCTACGCCGACCACCTCGCCGCCGCCGGC
CGCGGGCAAGCCGTCGTGCGGTGCCAGGCCGGGCCGGCGGCGCGGGCGTCGGAGCTCGTC
GCGCTGGCCAAGTCGCAGGTGGACTACATCCTGGGTAGCAACCCGAGGGGGATTAGCTAC
ATGGTCGGCTATGGCGCGAGGTACCCGCGGCGCGCGCACCACCGCGGCGCGTCCATCGTC
TCCATCAGGGCCAACCCGTCGTTCGTGAGCTGCAAGGATGGGTACGCGAGCTGGTTCGGC
CGCGCCGGCAGCAACCCGAACCTGCTCGACGGCGCCGTGGTCGGCGGCCCCGACGGGCGC
GACGGCTTCGCCGACGAGAGGAACAACTACCAGCAGACGGAGGTGGCCACCTACAACAAC
GCGCCGCTCATGGGCGTCCTCGCTCGCCTCGCCGGCGGCGGCCGCGGCGGGCTCGCCGAA
GCAGCGATCAAGAGGCCGGACAACCAGACCTTGCTGCCACCTCTCGCAGCTGCGGCGTCG
CCGGTGGAGATCACGCAGCTGAACGCGACGGCGTCGTGGAAGAAGGACGGGAGGACGTAC
CGCCGGTACGCGGCGACGGTGAGCAACAGGTCGCCGGCCGGCGGCAAGACGGTCGAGGAG
CTCCACATCGGCATCGGCAAGCCGCACGGCCCGGTGTGGGGGCTCGAGAAGGCGGCGAGG
TACGGCTACGTGCTCCCGTCGTCGCTGGCCGCCGGCGAGAGCGCCGCCTTCGCCTACGTT
GTCCGCGGCCGCGCCGCGCCGCCGCCGGCTGACGtctgggtcatcggctacaagctcgtc
tga

Protein

641 aa

>Os01t0219600-00 Similar to Endo-beta-1,4-glucanase precursor (EC 3.2.1.4).
MARRGGAAASSSMANLLGVALVLAATAQTSARGGGGGGRHDYRMALSKSILYFEAQRSGV
LPGNQRIAWRANSGLADGKANGVDLVGGYYDAGDNVKFGFPMAFTVTMMAWSVLEYGKQM
AAAGELGHAMDAVRWGADYFVKAHPAPNVLYGEVGDGDSDHVCWQRPEDMTTSRQAYRLD
PQHPGSDLAGETATALAAASLVFRSSNPGYANQLLQHSKQLFDFADKYRGKYDDSMPVVK
KFYGSFSGYGDELLWASAWLYQATDNRRYLDYLANNGDALGGTGWATNEFGWDVKYPGVQ
VLAAKFLLQGKAGPHAAVLRRYQRNADVFACSCLGKGGGGGNVGRTPGGLMYHQGWNNLQ
FVTGASFLLAVYADHLAAAGRGQAVVRCQAGPAARASELVALAKSQVDYILGSNPRGISY
MVGYGARYPRRAHHRGASIVSIRANPSFVSCKDGYASWFGRAGSNPNLLDGAVVGGPDGR
DGFADERNNYQQTEVATYNNAPLMGVLARLAGGGRGGLAEAAIKRPDNQTLLPPLAAAAS
PVEITQLNATASWKKDGRTYRRYAATVSNRSPAGGKTVEELHIGIGKPHGPVWGLEKAAR
YGYVLPSSLAAGESAAFAYVVRGRAAPPPADVWVIGYKLV*

CDS

chr01:6544216..6544461 (- strand) : 246 bp

chr01:6543886..6544098 (- strand) : 213 bp

chr01:6543536..6543736 (- strand) : 201 bp

chr01:6543330..6543419 (- strand) : 90 bp

chr01:6543076..6543240 (- strand) : 165 bp

chr01:6541971..6542978 (- strand) : 1008 bp

FASTA

>Os01t0219600-00 class=Sequence position=chr01:6541971..6544461 (- strand)
ATGGCCAGGA GAGGAGGAGC AGCAGCATCG TCGTCCATGG CTAATCTCCT CGGCGTCGCC TTGGTGCTCG CCGCCACGGC
GCAGACGTCG GCGCGTGGCG GCGGCGGCGG CGGACGCCAT GACTACCGCA TGGCGCTGAG CAAGAGCATC CTCTACTTCG
AGGCGCAGCG CTCCGGCGTG CTCCCCGGTA ACCAGAGGAT CGCATGGAGG GCCAACTCCG GCCTCGCCGA CGGCAAGGCC
AACGGCGTAC GTGCTCCCGC CATTGTGGCA GCTAGCAAAC CTGCAATCTT TCTCTGCTCT TGATCTTGAT CAGTACGGTT
TAATTTGCAA GAACGTGTTC TATTCTACAC ATCTACATTT CAGGTGGATC TTGTTGGTGG CTACTACGAC GCCGGAGACA
ACGTCAAGTT CGGGTTCCCG ATGGCGTTCA CGGTGACCAT GATGGCGTGG AGCGTCCTCG AGTACGGGAA GCAGATGGCG
GCCGCCGGCG AGCTCGGCCA CGCCATGGAC GCCGTCAGGT GGGGCGCCGA CTACTTCGTC AAGGCGCACC CGGCGCCCAA
CGTGCTCTAC GGCGAGGTCG GCCGGCGACC ATCCATCCAT GAATTCCTTT TGATTTGTCT CGATTCGTGT GCATAAATGT
AGTGGTTTTA CTTTTTTATA TGACCTGTAG TAGCAGCACA CATTTTTGGA GTGTTGTACA TGAATTGTTT GCTTCCATTC
TGCAGGTTGG AGATGGTGAC TCGGACCACG TCTGCTGGCA GCGGCCGGAG GACATGACGA CGAGCCGTCA GGCGTATCGC
CTTGACCCTC AGCATCCTGG CTCTGACCTC GCCGGAGAAA CCGCCACGGC ATTGGCCGCC GCGTCGCTCG TCTTCCGTAG
CTCCAACCCG GGCTACGCAA ACCAACTCCT GCAACACTCC AAGCAGGTAT CTTCAATTCG AATTTAATCC GACATGACTA
AACCAACAAC AACAACAAAA AATATTCACA AGATTAGTTT GAACTATTGC TGAAATATAC CTAAATTTCT TCATGTGCCC
AGCTGTTTGA TTTCGCCGAC AAGTACCGGG GAAAGTACGA CGACAGCATG CCTGTCGTGA AGAAATTTTA CGGGTCATTC
AGCGGATACG GGGTATGTTT CCGACAAAAT GAATAACCAC GTTCTTGAGA ACCGGCCATA TCTTCGTCAT CCGATGACGA
TATCCGATGT ATGCGCTTCA GGATGAACTA CTGTGGGCAT CGGCATGGCT ATACCAGGCG ACCGACAACC GCCGCTACCT
AGATTACTTG GCCAACAATG GTGACGCACT CGGCGGGACC GGTTGGGCTA CCAACGAATT CGGCTGGGAC GTCAAGTACC
CCGGAGTGCA AGTCCTAGCT GCAAAGGTCT GAAATGCTAC AGTGATTACC ACATTTTGTC GGATACAAGA GTAGTACTAC
TCACCCCAAC ACTGTACTTA TACTTACATT CCTTTTGATG TAGTTTCTCC TGCAAGGGAA GGCCGGGCCG CACGCCGCCG
TGCTGCGGAG GTACCAGCGG AACGCCGACG TCTTCGCGTG CTCCTGCCTC GGCAAGGGCG GCGGCGGTGG CAACGTCGGG
AGGACGCCCG GCGGCCTGAT GTACCACCAG GGCTGGAACA ACCTCCAGTT CGTCACCGGC GCGTCGTTCC TGCTGGCCGT
CTACGCCGAC CACCTCGCCG CCGCCGGCCG CGGGCAAGCC GTCGTGCGGT GCCAGGCCGG GCCGGCGGCG CGGGCGTCGG
AGCTCGTCGC GCTGGCCAAG TCGCAGGTGG ACTACATCCT GGGTAGCAAC CCGAGGGGGA TTAGCTACAT GGTCGGCTAT
GGCGCGAGGT ACCCGCGGCG CGCGCACCAC CGCGGCGCGT CCATCGTCTC CATCAGGGCC AACCCGTCGT TCGTGAGCTG
CAAGGATGGG TACGCGAGCT GGTTCGGCCG CGCCGGCAGC AACCCGAACC TGCTCGACGG CGCCGTGGTC GGCGGCCCCG
ACGGGCGCGA CGGCTTCGCC GACGAGAGGA ACAACTACCA GCAGACGGAG GTGGCCACCT ACAACAACGC GCCGCTCATG
GGCGTCCTCG CTCGCCTCGC CGGCGGCGGC CGCGGCGGGC TCGCCGAAGC AGCGATCAAG AGGCCGGACA ACCAGACCTT
GCTGCCACCT CTCGCAGCTG CGGCGTCGCC GGTGGAGATC ACGCAGCTGA ACGCGACGGC GTCGTGGAAG AAGGACGGGA
GGACGTACCG CCGGTACGCG GCGACGGTGA GCAACAGGTC GCCGGCCGGC GGCAAGACGG TCGAGGAGCT CCACATCGGC
ATCGGCAAGC CGCACGGCCC GGTGTGGGGG CTCGAGAAGG CGGCGAGGTA CGGCTACGTG CTCCCGTCGT CGCTGGCCGC
CGGCGAGAGC GCCGCCTTCG CCTACGTTGT CCGCGGCCGC GCCGCGCCGC CGCCGGCTGA CGtctgggtc atcggctaca
agctcgtctg a

Locus: Os01g0219600

Loading...

Locus: Os01g0219600

Loading...