Os01t0223200-01

Locus

Os01g0223200

Description

Lipase, GDSL domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GELP12

CGSNL Gene Name

GDSL ESTERASE/LIPASE PROTEIN 12

Oryzabase Gene Symbol Synonym(s)

OsGELP12, OsGELP12a, OsGELP12b, OsGELP12c

Oryzabase Gene Name Synonym(s)

GDSL esterase/lipase protein 12

Transcript Evidence

AK067352 (DDBJ, Best hit)

Protein Evidence

Q6H8W7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Lipase, GDSL (IPR001087)

Esterase, SGNH hydrolase-type, subgroup (IPR013831)

Full-length cDNA

J013101L22 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0223200-01)

RiceXPro (AK067352)

Others

Oryzabase (9093)

KEGG (Os01t0223200-01)

Transcript

1406 bp

>Os01t0223200-01 Lipase, GDSL domain containing protein.
AGAACACGAAAGATGATCATGTTGTGGCTGCCCGCCGCCGTCTCGCTCCTCCTCTCGTCG
TCGCTGCATGTCGCCGGTGACGCCGGCGGCGGCGTCGCCTCCCTCTCCGTCCGGCGCTAC
GACGCCATCTTCAGCTTCGGCGACTCCTTGGCCGACACCGGCAACAACCCCGTCGTCTTC
GACTGGTACTCCATCTTCGACCCCGTCACCCGCCCTCCCTACGGCTCCACCTTCTTCGGC
CGCCCCACCGGCCGCAACTGCGACGGCCGCCTCGTCCTCGACTTCGTCGCCGAACGCCTG
GGCCTGCCGTTGGTGCCGCCGTTCTTGGCTTACAACGGGAGCTTCCGGCACGGCGCCAAC
TTCGCCGTCGGCGCCGCCACCGCACTCGACTCCAGCTTCTTCCACGGCGCCGGCGATCCC
CCGGGCGCCAGCCCGTTCCCTCTCAACACCAGCCTAAGCGTGCAGCTGAGCTGGTTCGAT
TCACTCAAGCCCTCACTCTGCAGCACAACTCAAGAATGCAAGGATTTCTTCGGCAGATCG
CTCTTCTTCGTCGGCGAATTCGGCATCAACGACTACCACTCCTCCTTCGGGAGGAGgagc
atgcaagaaatcagatcgttcgtcccggacatcatccgtaccatctccatggccgtcgag
AAGCTGATTGGCGACGGGGCGACCACGGTGGTGGTTCCGGGCATGATCCCGTCGGGATGC
TCGCCGCCGGTGCTCGTCACCTTCGCCGACGCCGGCGCGGCGGAGTACGACGCGAGCACC
GGCTGCCTGAGGGAGCCCAACGAGGTAGCGACGCTGCACAACTCGCTGCTTCTGGACGCC
GTCGAGGAGCTCCGGGAGAAGCACCCGGATGTCGCCATCATGCACACCGATTTGTTCAGA
CACGTCTCGGAGATGGTCCAGAATCCTGACAAGTTTGGGTTTCAAAAGGATGTTCTCAGC
GTTTGCTGTGGAGGTCCCGGAAAATACCACTACAACACCAGGATAATCTGCGGCGATGAA
GGTGCGACCACCTGTGTGGATCCATCCAAGAGCTTGTACTGGGACGGCGTCCACTTAACC
GAGGCAGCTTACCACTACATCGCCGATGATTGGCTTCATGCCATAACCTTATCTGCAAGA
GCTACCTCCTAAAATTGATATGGCACGAACGTCGGATACACACATGTAATGCTAGTTTTT
TTTTTAAAAAGAACTACATGTAATGTTAGTTGTTGGTCGATTTTCCTTCGTGAAGGAACA
TCAGCCTTGCAGATGATCCGAGTAAAATTGTGGAGAAAAAACTCCTCTATTCAATTAAAT
TGGCGGTCTCATCGATTCGTTCAAAAAAAATTATGAAAAAAACTGCTGAACGGATGGATA
TTTGAATAAAATTCGTTCTTGTTGTG

CDS

1140 bp

>Os01t0223200-01 Lipase, GDSL domain containing protein.
ATGATCATGTTGTGGCTGCCCGCCGCCGTCTCGCTCCTCCTCTCGTCGTCGCTGCATGTC
GCCGGTGACGCCGGCGGCGGCGTCGCCTCCCTCTCCGTCCGGCGCTACGACGCCATCTTC
AGCTTCGGCGACTCCTTGGCCGACACCGGCAACAACCCCGTCGTCTTCGACTGGTACTCC
ATCTTCGACCCCGTCACCCGCCCTCCCTACGGCTCCACCTTCTTCGGCCGCCCCACCGGC
CGCAACTGCGACGGCCGCCTCGTCCTCGACTTCGTCGCCGAACGCCTGGGCCTGCCGTTG
GTGCCGCCGTTCTTGGCTTACAACGGGAGCTTCCGGCACGGCGCCAACTTCGCCGTCGGC
GCCGCCACCGCACTCGACTCCAGCTTCTTCCACGGCGCCGGCGATCCCCCGGGCGCCAGC
CCGTTCCCTCTCAACACCAGCCTAAGCGTGCAGCTGAGCTGGTTCGATTCACTCAAGCCC
TCACTCTGCAGCACAACTCAAGAATGCAAGGATTTCTTCGGCAGATCGCTCTTCTTCGTC
GGCGAATTCGGCATCAACGACTACCACTCCTCCTTCGGGAGGAGgagcatgcaagaaatc
agatcgttcgtcccggacatcatccgtaccatctccatggccgtcgagAAGCTGATTGGC
GACGGGGCGACCACGGTGGTGGTTCCGGGCATGATCCCGTCGGGATGCTCGCCGCCGGTG
CTCGTCACCTTCGCCGACGCCGGCGCGGCGGAGTACGACGCGAGCACCGGCTGCCTGAGG
GAGCCCAACGAGGTAGCGACGCTGCACAACTCGCTGCTTCTGGACGCCGTCGAGGAGCTC
CGGGAGAAGCACCCGGATGTCGCCATCATGCACACCGATTTGTTCAGACACGTCTCGGAG
ATGGTCCAGAATCCTGACAAGTTTGGGTTTCAAAAGGATGTTCTCAGCGTTTGCTGTGGA
GGTCCCGGAAAATACCACTACAACACCAGGATAATCTGCGGCGATGAAGGTGCGACCACC
TGTGTGGATCCATCCAAGAGCTTGTACTGGGACGGCGTCCACTTAACCGAGGCAGCTTAC
CACTACATCGCCGATGATTGGCTTCATGCCATAACCTTATCTGCAAGAGCTACCTCCTAA

Protein

379 aa

>Os01t0223200-01 Lipase, GDSL domain containing protein.
MIMLWLPAAVSLLLSSSLHVAGDAGGGVASLSVRRYDAIFSFGDSLADTGNNPVVFDWYS
IFDPVTRPPYGSTFFGRPTGRNCDGRLVLDFVAERLGLPLVPPFLAYNGSFRHGANFAVG
AATALDSSFFHGAGDPPGASPFPLNTSLSVQLSWFDSLKPSLCSTTQECKDFFGRSLFFV
GEFGINDYHSSFGRRSMQEIRSFVPDIIRTISMAVEKLIGDGATTVVVPGMIPSGCSPPV
LVTFADAGAAEYDASTGCLREPNEVATLHNSLLLDAVEELREKHPDVAIMHTDLFRHVSE
MVQNPDKFGFQKDVLSVCCGGPGKYHYNTRIICGDEGATTCVDPSKSLYWDGVHLTEAAY
HYIADDWLHAITLSARATS*

5'UTR

chr01:6728527..6728538 (- strand) : 12 bp

CDS

chr01:6728250..6728526 (- strand) : 277 bp

chr01:6727921..6728145 (- strand) : 225 bp

chr01:6727665..6727810 (- strand) : 146 bp

chr01:6727300..6727576 (- strand) : 277 bp

chr01:6725200..6725414 (- strand) : 215 bp

3'UTR

chr01:6724946..6725199 (- strand) : 254 bp

FASTA

>Os01t0223200-01 class=Sequence position=chr01:6724946..6728538 (- strand)
AGAACACGAA AGATGATCAT GTTGTGGCTG CCCGCCGCCG TCTCGCTCCT CCTCTCGTCG TCGCTGCATG TCGCCGGTGA
CGCCGGCGGC GGCGTCGCCT CCCTCTCCGT CCGGCGCTAC GACGCCATCT TCAGCTTCGG CGACTCCTTG GCCGACACCG
GCAACAACCC CGTCGTCTTC GACTGGTACT CCATCTTCGA CCCCGTCACC CGCCCTCCCT ACGGCTCCAC CTTCTTCGGC
CGCCCCACCG GCCGCAACTG CGACGGCCGC CTCGTCCTCG ACTTCGTCGG TCCGGTCATC TTCTCCCGCG CCGTCGATTC
ATCGATGCGC GGCCAAGCGT GAATTAATTT GCTGTGATCA TGGTGGATTT TGATTTTCTC TGTTTGCTTG CAGCCGAACG
CCTGGGCCTG CCGTTGGTGC CGCCGTTCTT GGCTTACAAC GGGAGCTTCC GGCACGGCGC CAACTTCGCC GTCGGCGCCG
CCACCGCACT CGACTCCAGC TTCTTCCACG GCGCCGGCGA TCCCCCGGGC GCCAGCCCGT TCCCTCTCAA CACCAGCCTA
AGCGTGCAGC TGAGCTGGTT CGATTCACTC AAGCCCTCAC TCTGCAGCAC AACTCAAGGT GGTTAATTAA TCAATCACGA
TCAGTTGTTG ATCCATCTCC AAGATAATTA AGCTGAAATT TACCAATCAA GAACCACTTT GTGCTCACGT AATTGATTAG
TGACGCAGAA TGCAAGGATT TCTTCGGCAG ATCGCTCTTC TTCGTCGGCG AATTCGGCAT CAACGACTAC CACTCCTCCT
TCGGGAGGAG gagcatgcaa gaaatcagat cgttcgtccc ggacatcatc cgtaccatct ccatggccgt cgaggcaaga
acaacacacc ctTTGACCGA TCCTACCGAG AAATCAAACA GTTCATCAAT TATGCGTGGA TTAATGAATT GTGTGGAAGC
AGAAGCTGAT TGGCGACGGG GCGACCACGG TGGTGGTTCC GGGCATGATC CCGTCGGGAT GCTCGCCGCC GGTGCTCGTC
ACCTTCGCCG ACGCCGGCGC GGCGGAGTAC GACGCGAGCA CCGGCTGCCT GAGGGAGCCC AACGAGGTAG CGACGCTGCA
CAACTCGCTG CTTCTGGACG CCGTCGAGGA GCTCCGGGAG AAGCACCCGG ATGTCGCCAT CATGCACACC GATTTGTTCA
GACACGTCTC GGAGATGGTC CAGAATCCTG ACAAGTTTGG TAAGTACAAT TATTTACTAC CCCAATCATT AGAATGCGAT
GCACGCCAAT CGTTTAATAA ATCTGTTTGG ACGTGTACAT CGGCTTGATG GATATTTTAT ATAAAGATCG GACTTAATCC
AATATATAAA ACATTAATAA ATCCACATCA TAAATGATAC TCCCTCTGAT TTCGATCGAA CCAAAGTCAT ACATAAGATG
GAGGAAGTAG TATGATATGT TTGTATACTT ACAAGTTTAT TATTATGTAA AATGGAAGTG GTCAAACTAA AAGTCTAACA
TATTCAATAT TAACAAAAGT GTTcccttca cttttaaata catgatgttg ttggcatacg taaatgtaat ttattttgtg
gtgggtagct tgttttattg ttaaatgtac tttaagtatc acttattttt tatatttgca ctcaatgtat ttttaaataa
gataaatagt caaatatatt ctaaaaatca acAACGATat cctatcttac tataaagtta tcctccacta actccttaag
cttaacatgt aaggatgtca catcatcatc cactaacaag atgcatgcca catcatcatc cactaacaat catcacattt
aaacatcata caaacatgct atatctttat agtttttata atttaagagc ttttcaaata caaacatgtt aaattatcat
ccaacataat tcacataata tttcaatgta tatctttatt atgttttatg atatcatata tacttatata gttcatcatc
acttagttag tgcttaaatg attaatctat gatccatatt atctttcttc tttttttccc tcaaattaag tcatatcata
tcaattgttt ttaggcttta gatgattaat ctacggttca aactttctcc ctacttttct tcttccataa agtcacacct
ccttactttt tacgtttgaa tcaccattct acatactatt taaatttaaa ttattataaa ccacattaat ttacttaatc
tgatgttatc tagatatctt acacgttatt tttttttatt gttatcatac taaattctcg cagcaatgcg cggggtttca
cctagtatat ttttaaatga agGTAGTATT ATTATAAAAG AATGGGATGC TCGCTAACCA TTAACCACTC ATCAGTACCA
TGCGATGAGC GCCCATCATT TAATAAATTT GCATAATAAA TACTCGTGAC GTTTCAACTG AGAATATATT TAACAATTTT
AACTAATAGT GGTTGTAATT GATACTCCTT TTCTTTTATT TTCTTAGTTA TATAGCTGTG TATTGTAACA TGATCATAAT
TCATAGTGTT TTCAAGGGTA CTTTTACCGG TTTTTGAGGG GAGTTTTCTT TTTTTTAGAA AAAGAGAGGG AGTGGTTATT
TTAGAGGAGG AAGGAGAATG ACTGCGCTTT TGAAATAATT AAGAAAGATA TTGGTTAATT GAAAAATTGA ACATCACATA
AAACAAAATG GAGGGAGTAT AATTTTCTGC ACTTACAATA ATATGATATC TTTGTCTACT CGTAAGTTTA TTTACAAAAT
ATAAGCGGTC AACAAAAAAA ATGGTCTTTT AATAAACCGT ATCTTATAGG ACGTCAAAAG AATTTAAGTC GAATATTATT
TTATCCATAA AAAATATGAT ACACATATAC ATGACATTAG GAATGGAAAT GGGATCTGCT GTCATATACT ACATGTGCAA
TTGAACCCCA ATATATATAT AGCCACAGCA AAGTAGAATT CACATATTAG TGACCTGTGC AATTAAGTCT GACGATCTAC
TTCCATGGCA TTGATGGGTC ATGGCCTCAT GGGTGCAACC ATAGAATTGA AGTAATCGGA GTTTGTATGG TGGTTAATTT
GTAGGGTTTC AAAAGGATGT TCTCAGCGTT TGCTGTGGAG GTCCCGGAAA ATACCACTAC AACACCAGGA TAATCTGCGG
CGATGAAGGT GCGACCACCT GTGTGGATCC ATCCAAGAGC TTGTACTGGG ACGGCGTCCA CTTAACCGAG GCAGCTTACC
ACTACATCGC CGATGATTGG CTTCATGCCA TAACCTTATC TGCAAGAGCT ACCTCCTAAA ATTGATATGG CACGAACGTC
GGATACACAC ATGTAATGCT AGTTTTTTTT TTAAAAAGAA CTACATGTAA TGTTAGTTGT TGGTCGATTT TCCTTCGTGA
AGGAACATCA GCCTTGCAGA TGATCCGAGT AAAATTGTGG AGAAAAAACT CCTCTATTCA ATTAAATTGG CGGTCTCATC
GATTCGTTCA AAAAAAATTA TGAAAAAAAC TGCTGAACGG ATGGATATTT GAATAAAATT CGTTCTTGTT GTG

Locus: Os01g0223200

Loading...

Locus: Os01g0223200

Loading...