Os01t0229400-01

Locus

Os01g0229400

Description

Similar to Rac-like GTP-binding protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC1

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 1

Oryzabase Gene Symbol Synonym(s)

OsRAC1, OsRac1, Os Rac1, Rac1, Os-Rac1

Oryzabase Gene Name Synonym(s)

small GTP-binding protein 1, Rac-like GTP-binding protein 1, GTPase Rac homolog, Rice homolog of mammalian Rac-GTPase RAC1

Transcript Evidence

AK071126 (DDBJ, Best hit)

Protein Evidence

Q9SSX0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Cellular Component: intracellular (GO:0005622)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTP-binding protein domain (IPR005225)

Full-length cDNA

J023077H07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0229400-01)

RiceXPro (AK071126)

Others

Oryzabase (2989)

KEGG (Os01t0229400-01)

Transcript

1163 bp

>Os01t0229400-01 Similar to Rac-like GTP-binding protein 1.
GGCAAGTTCAAACGGAGCTGGAGGCAGAGCTAGAGTGAGACTGTGAGAGTGAACAAGAGA
TAAGCTAAGCTAGTACAGCAACCAGCAAGAACAAAGAAGAGTGGCCGGAGTGGGCGGGGG
AGATGAGCTCGGCGGCGGCGGCGACGAGGTTCATCAAGTGCGTCACCGTGGGGGACGGCG
CGGTGGGGAAGACGTGCATGCTCATCTGCTACACCTGCAACAAGTTCCCCACCGATTACA
TCCCCACCGTGTTCGACAACTTCAGCGCCAATGTCTCCGTGGACGGGAGCGTCGTCAACC
TCGGCCTCTGGGACACTGCAGGTCAGGAGGATTACAGCAGGTTGAGGCCTCTGAGCTACA
GGGGAGCCGATGTGTTCATCCTGTCCTTCTCCCTGATAAGCAGGGCGAGCTATGAGAATG
TTCAGAAGAAGTGGATGCCAGAGCTTCGCCGGTTTGCGCCTGGTGTTCCTGTAGTTCTTG
TTGGAACCAAGTTGGGTATGCTATGCTATTCATTAATTCACCCTTTACCTTCTGAAATTT
CTTAATTTTTTGAACGCCATTCAACCCCACGAAGATATTTGATACAGTAACCACAGCCCA
GTGACATTCTTTGCTGATGCTGCATTACCGATTTCCTGTCTGTTCAGATCTCCGTGAAGA
TAGGGCCTATCTTGCTGATCATCCAGCTTCTTCCATAATAACAACGGAGCAGGGAGAAGA
ACTGAGGAAGCTAATAGGAGCGGTCGCCTACATCGAATGCAGCTCCAAGACACAGAGAAA
CATTAAAGCTGTTTTCGACACTGCCATCAAAGTGGTGCTTCAACCTCCAAGACATAAGGA
TGTAACCAGAAAGAAACTCCAATCAAGCTCCAATCGGCCAGTAAGGCGGTACTTTTGCGG
AAGCGCTTGTTTCGCGTAGTCAATAACCAAGAAGAAAAAAATGTGGTTTTTGTTCCATCA
CCATGATGTTCAGATGGCCCCATGGATCTACTCAGAATGGGATAGAAGATCATGGTTGAA
TCAACATTGCTTGCAGCTAGGAGGAACTTCTAGTTCTCTTTTTTTCTGCAGTGGAGCTCC
TTTTGTTTCTCCTTTCTCTTTTTTTCTTATGTTGTAAAAGCTCCAGAAAGTTTTACCCTT
GGTAATAAGATGTGCTCTTCTGG

CDS

423 bp

>Os01t0229400-01 Similar to Rac-like GTP-binding protein 1.
ATGAGCTCGGCGGCGGCGGCGACGAGGTTCATCAAGTGCGTCACCGTGGGGGACGGCGCG
GTGGGGAAGACGTGCATGCTCATCTGCTACACCTGCAACAAGTTCCCCACCGATTACATC
CCCACCGTGTTCGACAACTTCAGCGCCAATGTCTCCGTGGACGGGAGCGTCGTCAACCTC
GGCCTCTGGGACACTGCAGGTCAGGAGGATTACAGCAGGTTGAGGCCTCTGAGCTACAGG
GGAGCCGATGTGTTCATCCTGTCCTTCTCCCTGATAAGCAGGGCGAGCTATGAGAATGTT
CAGAAGAAGTGGATGCCAGAGCTTCGCCGGTTTGCGCCTGGTGTTCCTGTAGTTCTTGTT
GGAACCAAGTTGGGTATGCTATGCTATTCATTAATTCACCCTTTACCTTCTGAAATTTCT
TAA

Protein

141 aa

>Os01t0229400-01 Similar to Rac-like GTP-binding protein 1.
MSSAAAATRFIKCVTVGDGAVGKTCMLICYTCNKFPTDYIPTVFDNFSANVSVDGSVVNL
GLWDTAGQEDYSRLRPLSYRGADVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLV
GTKLGMLCYSLIHPLPSEIS*

5'UTR

chr01:7167298..7167419 (- strand) : 122 bp

CDS

chr01:7167187..7167297 (- strand) : 111 bp

chr01:7166972..7167059 (- strand) : 88 bp

chr01:7166685..7166794 (- strand) : 110 bp

chr01:7165887..7166000 (- strand) : 114 bp

3'UTR

chr01:7165720..7165886 (- strand) : 167 bp

chr01:7165370..7165435 (- strand) : 66 bp

chr01:7165148..7165254 (- strand) : 107 bp

chr01:7164742..7165019 (- strand) : 278 bp

FASTA

>Os01t0229400-01 class=Sequence position=chr01:7164742..7167419 (- strand)
GGCAAGTTCA AACGGAGCTG GAGGCAGAGC TAGAGTGAGA CTGTGAGAGT GAACAAGAGA TAAGCTAAGC TAGTACAGCA
ACCAGCAAGA ACAAAGAAGA GTGGCCGGAG TGGGCGGGGG AGATGAGCTC GGCGGCGGCG GCGACGAGGT TCATCAAGTG
CGTCACCGTG GGGGACGGCG CGGTGGGGAA GACGTGCATG CTCATCTGCT ACACCTGCAA CAAGTTCCCC ACCGTTGAGT
GCCGCGCCGC CGCTAATCCC TTCCTCTCCG TTCTTGCTCC GGCCCGCCGT GCTGGCCTAT CTTCTCTTCG GCTCGATTTG
GTTTGGTTTG GTTTGATTTG ATTCGGTTTG GTTTGGGCAG GATTACATCC CCACCGTGTT CGACAACTTC AGCGCCAATG
TCTCCGTGGA CGGGAGCGTC GTCAACCTCG GCCTCTGGGA CACTGCAGGT GGGGAAAGCT AGCTCAAGCT CACCCTCAAT
CTCAATCTCA AGCTGGGGCT TGCAAATCTT GTTCTCCTCT TTGATTTTAT TTTCTCAAGT GTTGCTGCTC ACTTGTGCTC
AGCTCAGAGA AAGATCTGAT TTAGTGATTT TGATTCTCGT TTTGGTTGGG GACTGTTGGT TGCAGGTCAG GAGGATTACA
GCAGGTTGAG GCCTCTGAGC TACAGGGGAG CCGATGTGTT CATCCTGTCC TTCTCCCTGA TAAGCAGGGC GAGCTATGAG
AATGTTCAGA AGAAGGTGAA CTGCTTAGAA ACCCCTTGTC ATTCTGATGC AATTTTTTAC TTGGTTGGAT ATGTTACTTT
CCTTCGCATT GCGCTAGTAG AATCGCTATG GTTTCCTGAT GCATTGCATT GGCAAGATTG TAGATATGTA GTTCAGAAAT
ACGCACTGTT TCAGGTATTC AGGTGGGCAT TATGCTGAGG AGGTATCATG TCAAACAAAC ATGGAAGAAT ATTAAAAGCA
TTGAACAATT TGTCGTGTGT AATAATAACG CTTTCTAAAA GCGTGATTCG TACAATTGCT TTCCTCGAAA AGAACAAGGC
CAGTTGAGCC GTGGAGACTT AGACTTTGCT CGTCACGCTT TTCTTTTGCA GCTGTTTGTG CATTATATGC AAGGTTATAA
TATAAAGCCG AAGATGAAAT TGCGAGCAAA GGAGATAATT TCTGTTAATG CCGAATTAAT TACCAGTTGA CAAAATTGTT
AGGAGTTGTG GCTCACTTTT GATTTACTTC GATAATGGTA AAACGCCTCC GGTTGTTTGC TCTATAATAG CTTCCTAATG
TAAATAAGAT ATCAACACGA AGCTTACTAC CTAGAGACAA GAAAGCCCAT TTACATGTAC ACCACATTGC ATCATGCTTT
GTCTCATTAC CTTTAGAATC TCTAAAGTGT GTACTAATGA CCTGACTTCA TCTGGACAGT GGATGCCAGA GCTTCGCCGG
TTTGCGCCTG GTGTTCCTGT AGTTCTTGTT GGAACCAAGT TGGGTATGCT ATGCTATTCA TTAATTCACC CTTTACCTTC
TGAAATTTCT TAATTTTTTG AACGCCATTC AACCCCACGA AGATATTTGA TACAGTAACC ACAGCCCAGT GACATTCTTT
GCTGATGCTG CATTACCGAT TTCCTGTCTG TTCAGATCTC CGTGAAGATA GGGCCTATCT TGCTGATCAT CCAGCTTCTT
CCATAATAAC AACGGAGCAG GTTGGTGTTT TGACTGTGAC AAGAGAATGA CACATTTTTG CCACATTTAG GTTAGCCAGG
TTTCACATTT TTAGGTCACA gtttggttca tgccaaagtt gtggctcaac acactttctg agcaccttgt cacacttgtc
acacacaatt tttccaaata cttgtggcaC TTGATTTGTT AGCCATGCTT TGTGTGTGTT GCCCACACTT TCGGAAGAAA
ACTGTGGCAA GATGTGGCAC ACATCCTCAA CAATGAGACT TTCCTGACTC TTTCTACATG TTAGGGAGAA GAACTGAGGA
AGCTAATAGG AGCGGTCGCC TACATCGAAT GCAGCTCCAA GACACAGAGA GTATGCTTCT GTTATACCCT ATGCAGGAAA
ACTTTGGAAT TTTGAGCTCC TTCATATTTA ATCATTTACT CACATCCTAA TCTAAAGAAA TGTTCTTTTT CTTGGTTACT
TGTAGAACAT TAAAGCTGTT TTCGACACTG CCATCAAAGT GGTGCTTCAA CCTCCAAGAC ATAAGGATGT AACCAGAAAG
AAACTCCAAT CAAGCTCCAA TCGGCCAGTA AGGTACCTTT GAAGTTTACA CTGTCTGCTC ACACTTCATC AGTCATCACT
TCATCAGTGG TGCATCATCT TTTCCAGTTC AGCATTTTGA TTTCCAATGA GGCCTTTGAC ACTTGATCAT GATTCTGTAG
GCGGTACTTT TGCGGAAGCG CTTGTTTCGC GTAGTCAATA ACCAAGAAGA AAAAAATGTG GTTTTTGTTC CATCACCATG
ATGTTCAGAT GGCCCCATGG ATCTACTCAG AATGGGATAG AAGATCATGG TTGAATCAAC ATTGCTTGCA GCTAGGAGGA
ACTTCTAGTT CTCTTTTTTT CTGCAGTGGA GCTCCTTTTG TTTCTCCTTT CTCTTTTTTT CTTATGTTGT AAAAGCTCCA
GAAAGTTTTA CCCTTGGTAA TAAGATGTGC TCTTCTGG

Locus: Os01g0229400

Loading...

Locus: Os01g0229400

Loading...