Os01t0229400-02

Locus

Os01g0229400

Description

Small GTP-binding protein, GTPase, Regulation of cell death, Disease resistance, Immune responses

RAP-DB Gene Symbol Synonym(s)

RAC1, OsRAC1, OsRac1, Os Rac1

RAP-DB Gene Name Synonym(s)

RAC/ROP-TYPE GTPASE 1, small GTP-binding protein 1, Rac-like GTP-binding protein 1, GTPase Rac homolog

CGSNL Gene Symbol

RAC1

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 1

Oryzabase Gene Symbol Synonym(s)

OsRAC1, OsRac1, Os Rac1, Rac1, Os-Rac1

Oryzabase Gene Name Synonym(s)

small GTP-binding protein 1, Rac-like GTP-binding protein 1, GTPase Rac homolog, Rice homolog of mammalian Rac-GTPase RAC1

Transcript Evidence

AB029508

Protein Evidence

Q9SSX0

Literature

PMID: 10485927

PMID: 11149940

Note

Manual Curation

November 26, 2014

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Molecular Function: GTP binding (GO:0005525)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Ras type (IPR020849)

Small GTPase superfamily, Rab type (IPR003579)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Small GTP-binding protein domain (IPR005225)

Others

Oryzabase (2989)

Transcript

976 bp

>Os01t0229400-02 Small GTP-binding protein, GTPase, Regulation of cell death, Disease resistance, Immune responses
GTGAGAGTGAACAAGAGATAAGCTAAGCTAGTACAGCAACCAGCAAGAACAAAGAAGAGT
GGCCGGAGTGGGCGGGGGAGATGAGCTCGGCGGCGGCGGCGACGAGGTTCATCAAGTGCG
TCACCGTGGGGGACGGCGCGGTGGGGAAGACGTGCATGCTCATCTGCTACACCTGCAACA
AGTTCCCCACCGATTACATCCCCACCGTGTTCGACAACTTCAGCGCCAATGTCTCCGTGG
ACGGGAGCGTCGTCAACCTCGGCCTCTGGGACACTGCAGGTCAGGAGGATTACAGCAGGT
TGAGGCCTCTGAGCTACAGGGGAGCCGATGTGTTCATCCTGTCCTTCTCCCTGATAAGCA
GGGCGAGCTATGAGAATGTTCAGAAGAAGTGGATGCCAGAGCTTCGCCGGTTTGCGCCTG
GTGTTCCTGTAGTTCTTGTTGGAACCAAGTTGGATCTCCGTGAAGATAGGGCCTATCTTG
CTGATCATCCAGCTTCTTCCATAATAACAACGGAGCAGGGAGAAGAACTGAGGAAGCTAA
TAGGAGCGGTCGCCTACATCGAATGCAGCTCCAAGACACAGAGAAACATTAAAGCTGTTT
TCGACACTGCCATCAAAGTGGTGCTTCAACCTCCAAGACATAAGGATGTAACCAGAAAGA
AACTCCAATCAAGCTCCAATCGGCCAGTAAGGCGGTACTTTTGCGGAAGCGCTTGTTTCG
CGTAGTCAATAACCAAGAAGAAAAAAATGTGGTTTTTGTTCCATCACCATGATGTTCAGA
TGGCCCCATGGATCTACTCAGAATGGGATAGAAGATCATGGTTGAATCAACATTGCTTGC
AGCTAGGAGGAACTTCTAGTTCTCTTTTTTTCTGCAGTGGAGCTCCTTTTGTTTCTCCTT
TCTCTTTTTTTCTTATGTTGTAAAAGCTCCAGAAAGTTTTACCCTTGGTAATAAGATGTG
CTCTTCTGGATGGCTA

CDS

645 bp

>Os01t0229400-02 Small GTP-binding protein, GTPase, Regulation of cell death, Disease resistance, Immune responses
ATGAGCTCGGCGGCGGCGGCGACGAGGTTCATCAAGTGCGTCACCGTGGGGGACGGCGCG
GTGGGGAAGACGTGCATGCTCATCTGCTACACCTGCAACAAGTTCCCCACCGATTACATC
CCCACCGTGTTCGACAACTTCAGCGCCAATGTCTCCGTGGACGGGAGCGTCGTCAACCTC
GGCCTCTGGGACACTGCAGGTCAGGAGGATTACAGCAGGTTGAGGCCTCTGAGCTACAGG
GGAGCCGATGTGTTCATCCTGTCCTTCTCCCTGATAAGCAGGGCGAGCTATGAGAATGTT
CAGAAGAAGTGGATGCCAGAGCTTCGCCGGTTTGCGCCTGGTGTTCCTGTAGTTCTTGTT
GGAACCAAGTTGGATCTCCGTGAAGATAGGGCCTATCTTGCTGATCATCCAGCTTCTTCC
ATAATAACAACGGAGCAGGGAGAAGAACTGAGGAAGCTAATAGGAGCGGTCGCCTACATC
GAATGCAGCTCCAAGACACAGAGAAACATTAAAGCTGTTTTCGACACTGCCATCAAAGTG
GTGCTTCAACCTCCAAGACATAAGGATGTAACCAGAAAGAAACTCCAATCAAGCTCCAAT
CGGCCAGTAAGGCGGTACTTTTGCGGAAGCGCTTGTTTCGCGTAG

Protein

215 aa

>Os01t0229400-02 Small GTP-binding protein, GTPase, Regulation of cell death, Disease resistance, Immune responses
MSSAAAATRFIKCVTVGDGAVGKTCMLICYTCNKFPTDYIPTVFDNFSANVSVDGSVVNL
GLWDTAGQEDYSRLRPLSYRGADVFILSFSLISRASYENVQKKWMPELRRFAPGVPVVLV
GTKLDLREDRAYLADHPASSIITTEQGEELRKLIGAVAYIECSSKTQRNIKAVFDTAIKV
VLQPPRHKDVTRKKLQSSSNRPVRRYFCGSACFA*

5'UTR

chr01:7167298..7167377 (- strand) : 80 bp

CDS

chr01:7167187..7167297 (- strand) : 111 bp

chr01:7166972..7167059 (- strand) : 88 bp

chr01:7166685..7166794 (- strand) : 110 bp

chr01:7165937..7166000 (- strand) : 64 bp

chr01:7165720..7165784 (- strand) : 65 bp

chr01:7165370..7165435 (- strand) : 66 bp

chr01:7165148..7165254 (- strand) : 107 bp

chr01:7164986..7165019 (- strand) : 34 bp

3'UTR

chr01:7164735..7164985 (- strand) : 251 bp

FASTA

>Os01t0229400-02 class=Sequence position=chr01:7164735..7167377 (- strand)
GTGAGAGTGA ACAAGAGATA AGCTAAGCTA GTACAGCAAC CAGCAAGAAC AAAGAAGAGT GGCCGGAGTG GGCGGGGGAG
ATGAGCTCGG CGGCGGCGGC GACGAGGTTC ATCAAGTGCG TCACCGTGGG GGACGGCGCG GTGGGGAAGA CGTGCATGCT
CATCTGCTAC ACCTGCAACA AGTTCCCCAC CGTTGAGTGC CGCGCCGCCG CTAATCCCTT CCTCTCCGTT CTTGCTCCGG
CCCGCCGTGC TGGCCTATCT TCTCTTCGGC TCGATTTGGT TTGGTTTGGT TTGATTTGAT TCGGTTTGGT TTGGGCAGGA
TTACATCCCC ACCGTGTTCG ACAACTTCAG CGCCAATGTC TCCGTGGACG GGAGCGTCGT CAACCTCGGC CTCTGGGACA
CTGCAGGTGG GGAAAGCTAG CTCAAGCTCA CCCTCAATCT CAATCTCAAG CTGGGGCTTG CAAATCTTGT TCTCCTCTTT
GATTTTATTT TCTCAAGTGT TGCTGCTCAC TTGTGCTCAG CTCAGAGAAA GATCTGATTT AGTGATTTTG ATTCTCGTTT
TGGTTGGGGA CTGTTGGTTG CAGGTCAGGA GGATTACAGC AGGTTGAGGC CTCTGAGCTA CAGGGGAGCC GATGTGTTCA
TCCTGTCCTT CTCCCTGATA AGCAGGGCGA GCTATGAGAA TGTTCAGAAG AAGGTGAACT GCTTAGAAAC CCCTTGTCAT
TCTGATGCAA TTTTTTACTT GGTTGGATAT GTTACTTTCC TTCGCATTGC GCTAGTAGAA TCGCTATGGT TTCCTGATGC
ATTGCATTGG CAAGATTGTA GATATGTAGT TCAGAAATAC GCACTGTTTC AGGTATTCAG GTGGGCATTA TGCTGAGGAG
GTATCATGTC AAACAAACAT GGAAGAATAT TAAAAGCATT GAACAATTTG TCGTGTGTAA TAATAACGCT TTCTAAAAGC
GTGATTCGTA CAATTGCTTT CCTCGAAAAG AACAAGGCCA GTTGAGCCGT GGAGACTTAG ACTTTGCTCG TCACGCTTTT
CTTTTGCAGC TGTTTGTGCA TTATATGCAA GGTTATAATA TAAAGCCGAA GATGAAATTG CGAGCAAAGG AGATAATTTC
TGTTAATGCC GAATTAATTA CCAGTTGACA AAATTGTTAG GAGTTGTGGC TCACTTTTGA TTTACTTCGA TAATGGTAAA
ACGCCTCCGG TTGTTTGCTC TATAATAGCT TCCTAATGTA AATAAGATAT CAACACGAAG CTTACTACCT AGAGACAAGA
AAGCCCATTT ACATGTACAC CACATTGCAT CATGCTTTGT CTCATTACCT TTAGAATCTC TAAAGTGTGT ACTAATGACC
TGACTTCATC TGGACAGTGG ATGCCAGAGC TTCGCCGGTT TGCGCCTGGT GTTCCTGTAG TTCTTGTTGG AACCAAGTTG
GGTATGCTAT GCTATTCATT AATTCACCCT TTACCTTCTG AAATTTCTTA ATTTTTTGAA CGCCATTCAA CCCCACGAAG
ATATTTGATA CAGTAACCAC AGCCCAGTGA CATTCTTTGC TGATGCTGCA TTACCGATTT CCTGTCTGTT CAGATCTCCG
TGAAGATAGG GCCTATCTTG CTGATCATCC AGCTTCTTCC ATAATAACAA CGGAGCAGGT TGGTGTTTTG ACTGTGACAA
GAGAATGACA CATTTTTGCC ACATTTAGGT TAGCCAGGTT TCACATTTTT AGGTCACAgt ttggttcatg ccaaagttgt
ggctcaacac actttctgag caccttgtca cacttgtcac acacaatttt tccaaatact tgtggcaCTT GATTTGTTAG
CCATGCTTTG TGTGTGTTGC CCACACTTTC GGAAGAAAAC TGTGGCAAGA TGTGGCACAC ATCCTCAACA ATGAGACTTT
CCTGACTCTT TCTACATGTT AGGGAGAAGA ACTGAGGAAG CTAATAGGAG CGGTCGCCTA CATCGAATGC AGCTCCAAGA
CACAGAGAGT ATGCTTCTGT TATACCCTAT GCAGGAAAAC TTTGGAATTT TGAGCTCCTT CATATTTAAT CATTTACTCA
CATCCTAATC TAAAGAAATG TTCTTTTTCT TGGTTACTTG TAGAACATTA AAGCTGTTTT CGACACTGCC ATCAAAGTGG
TGCTTCAACC TCCAAGACAT AAGGATGTAA CCAGAAAGAA ACTCCAATCA AGCTCCAATC GGCCAGTAAG GTACCTTTGA
AGTTTACACT GTCTGCTCAC ACTTCATCAG TCATCACTTC ATCAGTGGTG CATCATCTTT TCCAGTTCAG CATTTTGATT
TCCAATGAGG CCTTTGACAC TTGATCATGA TTCTGTAGGC GGTACTTTTG CGGAAGCGCT TGTTTCGCGT AGTCAATAAC
CAAGAAGAAA AAAATGTGGT TTTTGTTCCA TCACCATGAT GTTCAGATGG CCCCATGGAT CTACTCAGAA TGGGATAGAA
GATCATGGTT GAATCAACAT TGCTTGCAGC TAGGAGGAAC TTCTAGTTCT CTTTTTTTCT GCAGTGGAGC TCCTTTTGTT
TCTCCTTTCT CTTTTTTTCT TATGTTGTAA AAGCTCCAGA AAGTTTTACC CTTGGTAATA AGATGTGCTC TTCTGGATGG
CTA

Locus: Os01g0229400

Loading...

Locus: Os01g0229400

Loading...