Os01t0229700-00

Locus

Os01g0229700

Description

WD40 repeat domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-9, OsPUB71

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 71, U-box protein 71

Transcript Evidence

EU967646 (DDBJ)

Protein Evidence

NP_001042489.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

U box domain (IPR003613)

Soluble quinoprotein glucose/sorbosone dehydrogenase (IPR011041)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40 repeat 2 (IPR019782)

Expression Databases

TENOR (Os01t0229700-00)

Others

Oryzabase (10690)

Transcript

1425 bp

>Os01t0229700-00 WD40 repeat domain containing protein.
ATGGGCGGCGACGGCGGCGGCGACGTGGCGCGGCGGCCGGTGGTGGCGACGCCCAAGGAC
TTCGTGTGCCCGATCACGAGCCAGGTGTTCGACGACCCCGTCACGCTCGAGACCGGGCAG
ACGTACGAGCGCCGCGCCATCCAGGAGTGGCTCGACCGCGGCAACGCCACCTGCCCCATC
ACGCGCCACCGCCTCCACGGCGCCCACCTCCCCAGCACCAACTACGTCCTCAAGCGCCTC
ATCGCCGCCTGGCGCGACCAGAAccccgccgcctcctcctccgcgcccacgccgccgccg
ccggcgacgacgacgatggatagccccgccgccgcggccccgttcaagatcagctcgccg
tcgccggacgccaccgtgagccaggccagcgcgccgtcgccgaccagcgtcatcgcgcag
gcgtccctcgacagcgcagtcggcgagctccgcgccgcggtgtcctgcctctgcacgtcg
gaggagctcgccgactcggagaggtcggtgctccggatcgagcggctatggcgcgaggcc
gccggtgccgagcacgtcgtcctcgccgcgctcgccaagcccgccgtcgtcaacgGCTTC
GTGGAGATCCTCTTCAACTCCGTGAGCGCGCAGGTGCTCCAGGTGGCCGTCTTCCTCCTC
GCCGAGCTCGCCTCCCGCGACGACGCCGTCGTGCAGACGCTGACGAGGGTGGACTCCGAC
GTGGACTGCCTCGTCGCGCTCTTCAAGAAGGGCCTCGTCGAGGCCGTCTCGCTCATCCAC
CTCCTCTCCCCCTCGCCGGAGCAGCTTGTCGAGATGGACATGGCCGACGCGCTGGTCGCC
ACCATCCGGCGAGGCGGCGGCGACGACGACGGCGGCGCGGTGGTCAAGATGTGCGTCAAG
CCGAAGGCCGCGTCGGTGATCCTCCTGAGTCAGATCCTCGTCGAAGGCGGCCGGGACAGC
TCGTCGCCGGCGGTGGCCAAGTCCGCCCTGGTCTCCGAGAGGTTCATCAGGAGCGTGGCG
GCGAGCTTGGAAGCCGAGCAGGTGGAGGAGAGGGTCGCCGCCGTGAGGATCCTACTGCGG
TGCGTCGCCGAGGACGGCCATTGCCGGAGCAGCATCGTCGAGAACTCGGCCCTCGCCGCC
GTCCTCGACGCGTTCCACCTGACCAGGATCGGCGCTCTCCAGGCCGGCGGCGGCGGCGGC
AGCGGCCGGGTCCAGTGCATGGCCGTCGACGCCGACGGCGATGTCATCGTCGTCGGGACA
TCGGACGGCAGAATTCAGGTTTGGAAAAGAAAATGCATTTTTTTTTCTTCTTCTGTTTCT
TGGTTAAGGAATTGTAGAGAGCAGAGCTGGTTGAGAATGATGAGATTTGTTTGTGGTACT
CACATTGGGCTTGTCTTGGTTTTGCAGGCTTGGGGATTGACTTGA

CDS

1425 bp

>Os01t0229700-00 WD40 repeat domain containing protein.
ATGGGCGGCGACGGCGGCGGCGACGTGGCGCGGCGGCCGGTGGTGGCGACGCCCAAGGAC
TTCGTGTGCCCGATCACGAGCCAGGTGTTCGACGACCCCGTCACGCTCGAGACCGGGCAG
ACGTACGAGCGCCGCGCCATCCAGGAGTGGCTCGACCGCGGCAACGCCACCTGCCCCATC
ACGCGCCACCGCCTCCACGGCGCCCACCTCCCCAGCACCAACTACGTCCTCAAGCGCCTC
ATCGCCGCCTGGCGCGACCAGAAccccgccgcctcctcctccgcgcccacgccgccgccg
ccggcgacgacgacgatggatagccccgccgccgcggccccgttcaagatcagctcgccg
tcgccggacgccaccgtgagccaggccagcgcgccgtcgccgaccagcgtcatcgcgcag
gcgtccctcgacagcgcagtcggcgagctccgcgccgcggtgtcctgcctctgcacgtcg
gaggagctcgccgactcggagaggtcggtgctccggatcgagcggctatggcgcgaggcc
gccggtgccgagcacgtcgtcctcgccgcgctcgccaagcccgccgtcgtcaacgGCTTC
GTGGAGATCCTCTTCAACTCCGTGAGCGCGCAGGTGCTCCAGGTGGCCGTCTTCCTCCTC
GCCGAGCTCGCCTCCCGCGACGACGCCGTCGTGCAGACGCTGACGAGGGTGGACTCCGAC
GTGGACTGCCTCGTCGCGCTCTTCAAGAAGGGCCTCGTCGAGGCCGTCTCGCTCATCCAC
CTCCTCTCCCCCTCGCCGGAGCAGCTTGTCGAGATGGACATGGCCGACGCGCTGGTCGCC
ACCATCCGGCGAGGCGGCGGCGACGACGACGGCGGCGCGGTGGTCAAGATGTGCGTCAAG
CCGAAGGCCGCGTCGGTGATCCTCCTGAGTCAGATCCTCGTCGAAGGCGGCCGGGACAGC
TCGTCGCCGGCGGTGGCCAAGTCCGCCCTGGTCTCCGAGAGGTTCATCAGGAGCGTGGCG
GCGAGCTTGGAAGCCGAGCAGGTGGAGGAGAGGGTCGCCGCCGTGAGGATCCTACTGCGG
TGCGTCGCCGAGGACGGCCATTGCCGGAGCAGCATCGTCGAGAACTCGGCCCTCGCCGCC
GTCCTCGACGCGTTCCACCTGACCAGGATCGGCGCTCTCCAGGCCGGCGGCGGCGGCGGC
AGCGGCCGGGTCCAGTGCATGGCCGTCGACGCCGACGGCGATGTCATCGTCGTCGGGACA
TCGGACGGCAGAATTCAGGTTTGGAAAAGAAAATGCATTTTTTTTTCTTCTTCTGTTTCT
TGGTTAAGGAATTGTAGAGAGCAGAGCTGGTTGAGAATGATGAGATTTGTTTGTGGTACT
CACATTGGGCTTGTCTTGGTTTTGCAGGCTTGGGGATTGACTTGA

Protein

475 aa

>Os01t0229700-00 WD40 repeat domain containing protein.
MGGDGGGDVARRPVVATPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPI
TRHRLHGAHLPSTNYVLKRLIAAWRDQNPAASSSAPTPPPPATTTMDSPAAAAPFKISSP
SPDATVSQASAPSPTSVIAQASLDSAVGELRAAVSCLCTSEELADSERSVLRIERLWREA
AGAEHVVLAALAKPAVVNGFVEILFNSVSAQVLQVAVFLLAELASRDDAVVQTLTRVDSD
VDCLVALFKKGLVEAVSLIHLLSPSPEQLVEMDMADALVATIRRGGGDDDGGAVVKMCVK
PKAASVILLSQILVEGGRDSSSPAVAKSALVSERFIRSVAASLEAEQVEERVAAVRILLR
CVAEDGHCRSSIVENSALAAVLDAFHLTRIGALQAGGGGGSGRVQCMAVDADGDVIVVGT
SDGRIQVWKRKCIFFSSSVSWLRNCREQSWLRMMRFVCGTHIGLVLVLQAWGLT*

CDS

chr01:7181191..7182348 (- strand) : 1158 bp

chr01:7177355..7177621 (- strand) : 267 bp

FASTA

>Os01t0229700-00 class=Sequence position=chr01:7177355..7182348 (- strand)
ATGGGCGGCG ACGGCGGCGG CGACGTGGCG CGGCGGCCGG TGGTGGCGAC GCCCAAGGAC TTCGTGTGCC CGATCACGAG
CCAGGTGTTC GACGACCCCG TCACGCTCGA GACCGGGCAG ACGTACGAGC GCCGCGCCAT CCAGGAGTGG CTCGACCGCG
GCAACGCCAC CTGCCCCATC ACGCGCCACC GCCTCCACGG CGCCCACCTC CCCAGCACCA ACTACGTCCT CAAGCGCCTC
ATCGCCGCCT GGCGCGACCA GAAccccgcc gcctcctcct ccgcgcccac gccgccgccg ccggcgacga cgacgatgga
tagccccgcc gccgcggccc cgttcaagat cagctcgccg tcgccggacg ccaccgtgag ccaggccagc gcgccgtcgc
cgaccagcgt catcgcgcag gcgtccctcg acagcgcagt cggcgagctc cgcgccgcgg tgtcctgcct ctgcacgtcg
gaggagctcg ccgactcgga gaggtcggtg ctccggatcg agcggctatg gcgcgaggcc gccggtgccg agcacgtcgt
cctcgccgcg ctcgccaagc ccgccgtcgt caacgGCTTC GTGGAGATCC TCTTCAACTC CGTGAGCGCG CAGGTGCTCC
AGGTGGCCGT CTTCCTCCTC GCCGAGCTCG CCTCCCGCGA CGACGCCGTC GTGCAGACGC TGACGAGGGT GGACTCCGAC
GTGGACTGCC TCGTCGCGCT CTTCAAGAAG GGCCTCGTCG AGGCCGTCTC GCTCATCCAC CTCCTCTCCC CCTCGCCGGA
GCAGCTTGTC GAGATGGACA TGGCCGACGC GCTGGTCGCC ACCATCCGGC GAGGCGGCGG CGACGACGAC GGCGGCGCGG
TGGTCAAGAT GTGCGTCAAG CCGAAGGCCG CGTCGGTGAT CCTCCTGAGT CAGATCCTCG TCGAAGGCGG CCGGGACAGC
TCGTCGCCGG CGGTGGCCAA GTCCGCCCTG GTCTCCGAGA GGTTCATCAG GAGCGTGGCG GCGAGCTTGG AAGCCGAGCA
GGTGGAGGAG AGGGTCGCCG CCGTGAGGAT CCTACTGCGG TGCGTCGCCG AGGACGGCCA TTGCCGGAGC AGCATCGTCG
AGAACTCGGC CCTCGCCGCC GTCCTCGACG CGTTCCACGT CGTCGGCGAC GCCGACAAGT TCGACATCGT GCGGCTCCTC
TCCGAACTGC TCAAGCTCAA ACGGTAACCC CAAAGCTCCT CCATTTTACG GTCCTTAAAA AAAAAATCTC GAGTACCCTA
CTACTTAGAG gcagggttta caaaaccgta cgatcatcac acaattatca tgtgtgataa cattctcagt ttttaaatca
cggtaaacct cgcggtaacc gtacagttac ctcgataacc gccttttctg tggagtggtg gtaaccacat tcaaaacggt
ttgatgaaca ccaccTAGAG GTAGTAAACT TTACATTCAA AAATATATGG TATCTTCAGA TATCCTCTTA AGAATGACAA
AATTATCCAC ATCTAAAACA AAATCTCAAC TTATTTTTCA GGCGATCAGC TGCTGATCGT CTTCTTCGGA CGATCAAGGA
GGCGAGCTCC TTCAGCATGA TGCACACGCT TCTCGTGTAC CTGCAATCCA CGACACCGGA GCAGAGCCCT GTCGTTGCAG
GGCTACTTCT TCAGCTAGAT CTCCTAGTAA AAACAACTTT TTCTCGCAAC ATTTCTTCAG ATTTGTCAAA AAAAATCTCA
TGTTTGATGG CGAGATCAAT GCGCAAATGG TTTGTCAGGT GGAGCCGAGG AAGATCAGCA TGTACAGGGA GGAAGCAGTG
GACAGCCTCA TCCAGTGCCT CAAGAACTCG GATTACCCGA GAAGCCAGCT GCTCGCCGCC GAGACTATCA TGAATCTCTC
CGGCAAGTTC TCCTCGTCGG GCCGGCCACT CTCACGCTCA TCGCTGCTTA AGCTTGCCAG GGTGAAAGAG AGGCACCGGC
CGTCGCACGA TCTCAGCATT TCTCGCGGCG CCGGCGAGGA CGAAATGGTA GTATTgggaa actattttgg tcactaaagg
ggaatgtctc ctcagttcgc ttaaaaacca tcttatggtt atgaaaaatt ctttaaaaaa tttgaaaaca ctcatgcaac
atgtctataa aattttaggt ccaaactcaa ctcacacgtc gagatataaa aaaaaataca aattcagtgt gaataatagt
atattgttta catgtgaatt tgtctctttt ttttcacgat gagcaggtcg aatttgaact taatttttgg tgaactgata
gatatcaccg tactttacat tgccaatttt cagaagtttt ctctataaAA AAACCTGCTG GATTTCATAC ATCGAGTTCA
CTTGCGATGT TTTTTTTTTT TTTTGTAGGA GGAAGAGAAG GCGGCGGCGG AGTGGGAGAG GAAGGCGGCG TACGCGCTGG
TCAGCCATGA GTTCGGGCTG GTGTTCGAGG CGCTGTCGGG GTGCCTCGCG GCGGCCAAGA ACGGCGAGCT GTTCACGGCG
AGCCTCGTGT CGGCGGCATG GCTGGTCCGC ATGCTCCCCC TCCTCCCCGA CACCGGCGTG CTCGGCGCCG CCAGGGTGTG
CCTGCTCCGG CAGCTCGTGC TCGTCCTCCG GTCAGGCAAG CACGGCAGCG ACAGGGCCCT CGCCATGGTG GCCCTCAGGA
GCTTCATGAA CGATCGCGGT TGGTCACACC GTCCATTACC AATCTTGCCA CAAGAATTTC AGAAGAGAGA GAGAGAGAGA
GAGAGAGAGA ACTCTGAATT TTTTGTTATT TTTTGGTTCA GAAAGAAAGA ATCTCTGAAC ATTTTTATCC TAACATTGTG
AAATTTCAGA GGGGATGCAC GAGATCACGA CGTACATCAA GGACGTGCTC AGGACGCTCA GGGAGCTGAA GAAATCGTCC
GGCCTCGCGT TCGAGATGCT CAAGCTGCTG TCAGATGGAC AAGAATCCAG CATTGTAATT GCATTTTTCT CAGCTGTTCT
TGCAGCGAAT CTGAAATTCC GGTTTTTACT GAACATTTCT GTTCTTTTTG TTCCAGGATA TGTGGAATCA CAAGGAGCTC
AATCACGCAG ACTGCAGCTC GAATGGTGAG GTCACATCGA TCGCCTACTT CAAGGGCTAC ATCTTCTCCG GCCACTCTGA
TGGAACACTA AAGGTTTAAT TCTCTCTTTC AAAATTCCGA AATTTTTTTC CTGAGATCAT AACATTGTAG TTTCAGTTTT
AGAAATCTGT GGAATTTAAA TGTTCAGGTC TGGGAGGGAA GTGAGAATAT CCTTCGCCTA GTCCATGAAT CCCAAGAACA
CACGAAAGCA ATCACCAGCT TAGCAGTGCT ACACTCAGAG GAGAAACTGT TCAGTGGATC ACTGGATAGA ACTATCAGAG
TATGTCTAAA TTTTCTTGGC AAAATCATGA AACAAAAAAG ATCGCACAAA ATTTCAGAAA TTTAACATGT TCATCTCTGC
TGAACACCTG ATCACCAGGT GTGGCAGCTC CGAGACGCCC TCCGGTGCGT CGAGGTCCAC GACGCCAAGG ACCCGGTTCA
GAGCCTCGCC GTCGCCGCCG CCATGGCCTG CTTCGCGCCG CAGGGCTCCG GCGTCAAGGT GATCGATCGC CGATCACATC
ATCCGGCGAG GCGCTTCCAT GGATGGCCAC CTAACTTGGT CTGTGTTTTG CAGGTGCTAA GCTGGAACAA TGGTGGCGGC
GCCAAGGTCC TGAACGCGAG CAAGGTGGTG AGATCCATGG CGCTGGTGCA CGGGAAGCTC TTCTGCGGCT GCAACGACGG
CGGCGTGCAG GAGATCGACC TGGCGAGCGG GACGATCGGC GTGATCCAGC AAGGGAGCAA GAGGATCATC GGCAAGGCCA
GCCCGATCTA CTCTCTGCAT CTTCACGGCG ACCTCCTCTA CACCGGCAGC ACCTCGCTCG ACGGCGCATC AGTCAAGGTA
CCAATAAAAA AGCAAAAATG AAAAACTCGG AAAGCTTGAT AAAGTTTTGA CAGTTTGAAA CATGCCAAAG TTCGAACTCA
AATCATATAA CTCTCAACTG AAAATGTGTA CTTCATACAA AACAGTCGAC TCTATCATAC AACTTTCAAC TCTGGAAACA
TTTATGTGAA GAgtaatttt accatcctag aggtactatg ttttcttctg taaaatttga tacatctaga tactaattat
ttcaaggtac caaaattttt agtgtaaaat ttaggtacct caaggtactt tttcaagaac tttaaaattc ctcttaTCTG
AAAGTACGTG CTGAGAACAC AACTGCGCTA AATATAGCAA TTTCGACTTG AAACTCTCCG AAAAAAAATG TCATTCCTAT
AGAAGACCAA AACTATGAAA TATGTCGAGG CTCCGTTTGA AACACAGCAA AGTTTGACGA AATTTCAATC AGAACTGAAC
TGTACCCTGT GAAATTCATG CACACAGTCG ATGTATTAGT GTGGTTTCTG GTCTAGGCAT GTGGTGATGA TGAAATAGGA
TGTGAATTTT GTTCTCTTTT TTCTGGGTGC AGATATGGAG CAGCTCGAAC TACAGCCTGG TCGGGACGAT ACCGTCGTCG
GTGGAGGTGA GGTCGCTGGT GGTGAGCTCG GACCTGGTGT ACCTCGGCTC CAGGAATGGC GTCGTGGAGA TCTGGTCGAG
GGAGAAGCTG ACCAGGATCG GCGCTCTCCA GGCCGGCGGC GGCGGCGGCA GCGGCCGGGT CCAGTGCATG GCCGTCGACG
CCGACGGCGA TGTCATCGTC GTCGGGACAT CGGACGGCAG AATTCAGGTT TGGAAAAGAA AATGCATTTT TTTTTCTTCT
TCTGTTTCTT GGTTAAGGAA TTGTAGAGAG CAGAGCTGGT TGAGAATGAT GAGATTTGTT TGTGGTACTC ACATTGGGCT
TGTCTTGGTT TTGCAGGCTT GGGGATTGAC TTGA

Locus: Os01g0229700

Loading...

Locus: Os01g0229700

Loading...