Os01t0232000-00

Locus

Os01g0232000

Description

Major intrinsic protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TIP4;3

CGSNL Gene Name

TONOPLAST INTRINSIC PROTEIN 4;3

Oryzabase Gene Symbol Synonym(s)

OsTIP4;3, TIP4.3, TIP4-3

Oryzabase Gene Name Synonym(s)

Probable aquaporin TIP4.3, Probable aquaporin TIP4-3, Tonoplast intrinsic protein 4-3

Transcript Evidence

Q9LWR2 (UniProt)

Protein Evidence

Q9LWR2 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Biological Process: water transport (GO:0006833)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Major intrinsic protein (IPR000425)

Aquaporin (IPR012269)

Major intrinsic protein, conserved site (IPR022357)

Aquaporin-like (IPR023271)

Expression Databases

TENOR (Os01t0232000-00)

Others

Oryzabase (8386)

Transcript

756 bp

>Os01t0232000-00 Major intrinsic protein family protein.
ATGGCGAAGCTCGCGCTCGGCCACCACCGCGAGGCCACCGACCCCGGCTGCCTCCGCGCC
GTCGTCGCCGAGCTCCTCCTCACCTTCCTCTTCGTCTTCTCCGGCGTCGGCTCCGCCATG
GCCGCCGCCAAGCTGGGCGGCGGCGGCGACACGATAATGGGGCTGACGGCGGTGGCGGCG
GCGCACGCGCTGGTGGTCGCCGTCATGGTCTCCGCGGGGCTGCACGTCTCCGGCGGCCAC
ATCAACCCGGCCGTCACGCTCGGCCTCGCCGCCGGCGGCCACATCACCctcttccgctcc
gcgctctacgccgccgcccagctgctcggctcctccctcgcctgcctcctcctcgccgcc
ctcaccggcggcgaggaggccgtcccggtgcacgcgccggcgcccggcgtcggcgcggcg
cgcgccgtggccatggaggccgtgctcaccttctccctcctcttcgccgtctacgccacc
gtcgtcgaccggcgccgcgccgtcggcgcgctcggcccgctcctcgtcggcctcgtcgtc
ggcgccaacatcctcgccggcgggccctactccggcgcctccatgaacccggcccgctcc
ttcggcccggccctcgccgccggcgaatgggccgACCACTGGATCTATTGGGTTGGGCCT
CTTATAGGTGGGCCTTTGGCTGGGCTGGTTTATGAGGGCCTCTTCATGGGCCCGCCCGGC
CATGAGCCGCTTCCTAGGAATGACGGCGACTTCTAA

CDS

756 bp

>Os01t0232000-00 Major intrinsic protein family protein.
ATGGCGAAGCTCGCGCTCGGCCACCACCGCGAGGCCACCGACCCCGGCTGCCTCCGCGCC
GTCGTCGCCGAGCTCCTCCTCACCTTCCTCTTCGTCTTCTCCGGCGTCGGCTCCGCCATG
GCCGCCGCCAAGCTGGGCGGCGGCGGCGACACGATAATGGGGCTGACGGCGGTGGCGGCG
GCGCACGCGCTGGTGGTCGCCGTCATGGTCTCCGCGGGGCTGCACGTCTCCGGCGGCCAC
ATCAACCCGGCCGTCACGCTCGGCCTCGCCGCCGGCGGCCACATCACCctcttccgctcc
gcgctctacgccgccgcccagctgctcggctcctccctcgcctgcctcctcctcgccgcc
ctcaccggcggcgaggaggccgtcccggtgcacgcgccggcgcccggcgtcggcgcggcg
cgcgccgtggccatggaggccgtgctcaccttctccctcctcttcgccgtctacgccacc
gtcgtcgaccggcgccgcgccgtcggcgcgctcggcccgctcctcgtcggcctcgtcgtc
ggcgccaacatcctcgccggcgggccctactccggcgcctccatgaacccggcccgctcc
ttcggcccggccctcgccgccggcgaatgggccgACCACTGGATCTATTGGGTTGGGCCT
CTTATAGGTGGGCCTTTGGCTGGGCTGGTTTATGAGGGCCTCTTCATGGGCCCGCCCGGC
CATGAGCCGCTTCCTAGGAATGACGGCGACTTCTAA

Protein

251 aa

>Os01t0232000-00 Major intrinsic protein family protein.
MAKLALGHHREATDPGCLRAVVAELLLTFLFVFSGVGSAMAAAKLGGGGDTIMGLTAVAA
AHALVVAVMVSAGLHVSGGHINPAVTLGLAAGGHITLFRSALYAAAQLLGSSLACLLLAA
LTGGEEAVPVHAPAPGVGAARAVAMEAVLTFSLLFAVYATVVDRRRAVGALGPLLVGLVV
GANILAGGPYSGASMNPARSFGPALAAGEWADHWIYWVGPLIGGPLAGLVYEGLFMGPPG
HEPLPRNDGDF*

CDS

chr01:7297781..7297907 (+ strand) : 127 bp

chr01:7297991..7298619 (+ strand) : 629 bp

FASTA

>Os01t0232000-00 class=Sequence position=chr01:7297781..7298619 (+ strand)
ATGGCGAAGC TCGCGCTCGG CCACCACCGC GAGGCCACCG ACCCCGGCTG CCTCCGCGCC GTCGTCGCCG AGCTCCTCCT
CACCTTCCTC TTCGTCTTCT CCGGCGTCGG CTCCGCCATG GCCGCCGGTA ACCTGCCTAC TTCATTTCTT CTCCTAGTTT
TTCTTCTCAT CTCAATCAAG ATCGACATTG TCGTCCTTGC GTCGGTGCAG CCAAGCTGGG CGGCGGCGGC GACACGATAA
TGGGGCTGAC GGCGGTGGCG GCGGCGCACG CGCTGGTGGT CGCCGTCATG GTCTCCGCGG GGCTGCACGT CTCCGGCGGC
CACATCAACC CGGCCGTCAC GCTCGGCCTC GCCGCCGGCG GCCACATCAC Cctcttccgc tccgcgctct acgccgccgc
ccagctgctc ggctcctccc tcgcctgcct cctcctcgcc gccctcaccg gcggcgagga ggccgtcccg gtgcacgcgc
cggcgcccgg cgtcggcgcg gcgcgcgccg tggccatgga ggccgtgctc accttctccc tcctcttcgc cgtctacgcc
accgtcgtcg accggcgccg cgccgtcggc gcgctcggcc cgctcctcgt cggcctcgtc gtcggcgcca acatcctcgc
cggcgggccc tactccggcg cctccatgaa cccggcccgc tccttcggcc cggccctcgc cgccggcgaa tgggccgACC
ACTGGATCTA TTGGGTTGGG CCTCTTATAG GTGGGCCTTT GGCTGGGCTG GTTTATGAGG GCCTCTTCAT GGGCCCGCCC
GGCCATGAGC CGCTTCCTAG GAATGACGGC GACTTCTAA

Locus: Os01g0232000

Loading...

Locus: Os01g0232000

Loading...