Os01t0248600-01

Locus

Os01g0248600

Description

GINS complex, Psf2 component family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSF2

CGSNL Gene Name

PARTNER OF SLD FIVE 2

Oryzabase Gene Symbol Synonym(s)

PSF2

Oryzabase Gene Name Synonym(s)

partner of Sld five 2

Transcript Evidence

AK061039 (DDBJ, Best hit)

AK100824 (DDBJ, Best hit)

Protein Evidence

B6SJM9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

GINS complex, subunit Psf2 (IPR007257)

GINS complex, subunit Psf2, subgroup (IPR016906)

GINS complex (IPR021151)

Full-length cDNA

006-205-C12 (Online Clone Ordering)

J023122J02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0248600-01)

RiceXPro (AK061039)

Others

Oryzabase (7453)

KEGG (Os01t0248600-01)

Transcript

1221 bp

>Os01t0248600-01 GINS complex, Psf2 component family protein.
AAGCAGGCGGCAGCTAGGGTTGGAGTCGCCGCTGTTCCTCCCCTCGCCTCGCAGCCTCCG
CCTCTCCTCGTCTTTCCGGCTCAATCTGCGGAGAGGGTGGAGGCGCGCGCGGGCCACTGC
CACCGTGAGGCAGCCGCACTCGGGCACCGGGACCTCGGGAACCCTAGCCGGCTGGCCCCG
GTTTATTGCCTGCCCCTTCTGGCTGCTAGCGGCCGGGCTGCTTGACGATTTGTGGGTTTC
CCTTTCCCATTTGCTCAGACACTAAATCATCAAATAGAGGAAGCAATTTAGTGCCACGGT
GGTCAAGATGGCTGGGCAGTCTGACCCTCATCTTTCTATCTTCTCACCCTCAGAGGTGGA
GTTCGTGGCGGAGGATGAGATTGTCGAGATCGTCCCTAACATTCGCATGGAGGCCCTCAA
CATGATATGCGGGGATTTTGGGCCCTTCTTCCCGCAAATTGCAAGCAAAGTGCCTCTTTG
GCTCGCGGTTGCACTCAAGAAGCGTGGCAAATGTACCATACGCACACCTGACTGGATGAC
TGTTGACCGCTTGACGCAGGTATTAGATGCAGAAAGAGAGTCACCCAAAGAATTTCAGCC
ATTGCCGTTCCACTATATTGAAATATCTAAGCTTCTCTTTGATCATGCTCGTGATGACAT
CTCAGATGCATACCTGGTAAGATCTTTGATTGAGGACATCCGAGATGTCAGATTCCATAA
GGTTGAGACTGGTCTGGAGACAATATCTGGCCGTACTCATGCTGTAAAGCTAAAAAATCT
CTCTGCAATGGAAGTGAATATCGTGCGTCCTTTCATGGTGAGAACTTTACAAGCATTCTA
TAAGCATGATAGCCCACAGATGATTCAGCAGGCAGATAACACAGGTAGCAGACCAACACC
AGTTACAGACCGTGGTCCAAGAAGAGATCTAAGGCGCAGGTAACAAGCAGGATGTGTATC
TATCCCTTGAAAATTTTACTGTGTGTAGATTGCAGTAAATGAAGGTACTTGTGATCTGTA
TCTCACTAGCTAGAAGCCAACTGCGTTTCCCCAATTTGTTGTGTGTGTACCAAAATTTTA
TAGGACTAATAACATTTGACATGGTTTTGTTTTTGAAGAAGCGAAGATAGTAAGATACAT
CAATTATCTGTCACAAAAGGGAGATTCCTCATGTATTCTGGATGGATGTAACTTATGTGA
TGTATTTTTACTATTTCTGGC

CDS

636 bp

>Os01t0248600-01 GINS complex, Psf2 component family protein.
ATGGCTGGGCAGTCTGACCCTCATCTTTCTATCTTCTCACCCTCAGAGGTGGAGTTCGTG
GCGGAGGATGAGATTGTCGAGATCGTCCCTAACATTCGCATGGAGGCCCTCAACATGATA
TGCGGGGATTTTGGGCCCTTCTTCCCGCAAATTGCAAGCAAAGTGCCTCTTTGGCTCGCG
GTTGCACTCAAGAAGCGTGGCAAATGTACCATACGCACACCTGACTGGATGACTGTTGAC
CGCTTGACGCAGGTATTAGATGCAGAAAGAGAGTCACCCAAAGAATTTCAGCCATTGCCG
TTCCACTATATTGAAATATCTAAGCTTCTCTTTGATCATGCTCGTGATGACATCTCAGAT
GCATACCTGGTAAGATCTTTGATTGAGGACATCCGAGATGTCAGATTCCATAAGGTTGAG
ACTGGTCTGGAGACAATATCTGGCCGTACTCATGCTGTAAAGCTAAAAAATCTCTCTGCA
ATGGAAGTGAATATCGTGCGTCCTTTCATGGTGAGAACTTTACAAGCATTCTATAAGCAT
GATAGCCCACAGATGATTCAGCAGGCAGATAACACAGGTAGCAGACCAACACCAGTTACA
GACCGTGGTCCAAGAAGAGATCTAAGGCGCAGGTAA

Protein

212 aa

>Os01t0248600-01 GINS complex, Psf2 component family protein.
MAGQSDPHLSIFSPSEVEFVAEDEIVEIVPNIRMEALNMICGDFGPFFPQIASKVPLWLA
VALKKRGKCTIRTPDWMTVDRLTQVLDAERESPKEFQPLPFHYIEISKLLFDHARDDISD
AYLVRSLIEDIRDVRFHKVETGLETISGRTHAVKLKNLSAMEVNIVRPFMVRTLQAFYKH
DSPQMIQQADNTGSRPTPVTDRGPRRDLRRR*

5'UTR

chr01:8182851..8183108 (- strand) : 258 bp

chr01:8181731..8181779 (- strand) : 49 bp

CDS

chr01:8181683..8181730 (- strand) : 48 bp

chr01:8181505..8181579 (- strand) : 75 bp

chr01:8181026..8181140 (- strand) : 115 bp

chr01:8180434..8180533 (- strand) : 100 bp

chr01:8180311..8180341 (- strand) : 31 bp

chr01:8180123..8180215 (- strand) : 93 bp

chr01:8179600..8179752 (- strand) : 153 bp

chr01:8179318..8179338 (- strand) : 21 bp

3'UTR

chr01:8179040..8179317 (- strand) : 278 bp

FASTA

>Os01t0248600-01 class=Sequence position=chr01:8179040..8183108 (- strand)
AAGCAGGCGG CAGCTAGGGT TGGAGTCGCC GCTGTTCCTC CCCTCGCCTC GCAGCCTCCG CCTCTCCTCG TCTTTCCGGC
TCAATCTGCG GAGAGGGTGG AGGCGCGCGC GGGCCACTGC CACCGTGAGG CAGCCGCACT CGGGCACCGG GACCTCGGGA
ACCCTAGCCG GCTGGCCCCG GTTTATTGCC TGCCCCTTCT GGCTGCTAGC GGCCGGGCTG CTTGACGATT TGTGGGTTTC
CCTTTCCCAT TTGCTCAGGT GAGATGAAAT GGTGAACTAG AACTATGATG GTGAAATGAG TCTATGTTTC TTTGAAGTAT
TTTCCATTGC CAATTTGTGA TTTCTGATTT ATGAATCAGT GAATGCGCTG CGGAGTCGCT GTTTGTAGGA TTTGTAAAAC
ACGAAGATGA ATGGGGGTAT TACATCGCTT TGTAGGATTT TGTATTTGAA CTatatctat ataatattgt aatatttgca
cattttgaac ttgcttgtta taaattagtc gatcattgat gttatgagat attattgtta tttaactaaa tttgtacctg
tatatgagat ttgctgtatt cgaaaaattt tggtatgtga ttgaacttGT GAAGTAGGAC TAACCAACGA AAATTTCTTG
GCTACGCAAC CGAGGACTAC CAACGTAAAA TTCATGGCTA CGCCACTGCC CCTGCTGCCT GACGCCGTCG ACAATGACAG
GATGGTCGTA CACCATCGTC CCCCATCACG GATGACGACA GGACCGTGCA CTGCTCCGGC CCCATCAGGG GTACAGCCAC
CCTCAGTGGC GGCGGCAGGA TTGGCTCCTT GGTTCCTCCT GGTGTCACCA TCTGAAGCCA GACCTAAGGA ACATACTAAT
CCCATGTCTT TCCCATCTAC TTGTATCCTT ATTATGGCGC CCAAAGTTCT ATTAATTGGA CTGGTGATGG CTGTCATGGA
GATAATGCAA GTTAAGAATT ATACCCTAGC CCAGGGGCAA GACATTCTCA AAATTTGTCC GATTTCTCCA CACGAAATGT
GTACTGATCT TCTGAGTTTC TCAATTAGAT CTCCTGTTAT AATAGTGTAG TAGATCAGGT AAGAACACCT TATGCTGACA
AAACATGTGG AAAGAACACT TTTGAATCCA TATCAGTTGT TCAGTTCATA ACTTCAGATA TTTCTACGTT TAGGAATTAT
CTTGACAAGT TTGACAGGGT AGCATTTGCA TCACTCTTTG AAGAATGTAT GCTATAAAAG TTTGACATCA CAGACGCCAA
TAGGAATTGA ACAAACACTG ATTCACTTTC TTTTTCTTAA AGTTTACAGA CACTAAATCA TCAAATAGAG GAAGCAATTT
AGTGCCACGG TGGTCAAGAT GGCTGGGCAG TCTGACCCTC ATCTTTCTAT CTTCTCACCC TCAGAGGTAA TCAAGCCTAA
ATCAATCCTT TCCTCATTGA ATCATTTCAA GAGCAGGGTC TGGATTCATG GGTTCCAAGT TCATTTTGTT GGCCTATGTG
CTATTGCAGG TGGAGTTCGT GGCGGAGGAT GAGATTGTCG AGATCGTCCC TAACATTCGC ATGGAGGCCC TCAACATGAT
ATGCGTGAGT TGCCAGTCCC TTCACTGGCA TCTATTTTCA TTCATTTCTA TTTTTGAATA CTCTCACTGT CCACTCGTTT
TACCTCACAT TTATTTTTGG GTTGCTGCGC TTATCTTTCC TATGTACTTT ATGAATGATT AATTACATTA TACTCAAAAT
TCACATGTTT TGCTGTGATT GATCCTCGTT TCACTGGCCA GTTATAAATT CCTTTTGCTG TTTCATTGAC TATTGGTTGC
TTTTGCTCAG CTCATTTTCC AGATGAGGTT TTCTGTTTTC TGTCCCACAT GAGGTTTTCT GCTGTTTGAA GTCTCAATAC
GTCAAATTTG GTCAACGCAA CACTCATACT CACCAATTCA TCATATAGGG GGATTTTGGG CCCTTCTTCC CGCAAATTGC
AAGCAAAGTG CCTCTTTGGC TCGCGGTTGC ACTCAAGAAG CGTGGCAAAT GTACCATACG CACACCTGAC TGGATGACTG
TTGGTAAGTT CCTGCTTGCT TATCTGAGCT GCTTAATCTC ATGTTTTATC ATAGCCAACA TGTTTATAGT ATTTGCTGGT
ATAATAAATT AATAAATCAT AAAGAAAGGA GGTTCTGTGC CTAATCTTAT TACCAGTTAC TAAGTAGTAA TGCATTCAAC
CTACATGACA GATTGCGTAA CTATtactcc ctccgtccca taatataagg gattttggtg ggatgtgaca catcctagga
tagtcttagg atgcatcaca tccttccaaa atcccttata ttatgggaca gaaggagtaT ATTTTTCTCC CTGAAATTTC
TTGTCTGTGC ACTCTTATAG CATTTAATGT CACAATCTAA TAGAATAATA CTGTTTATAT TTGACATGCT TACATGTGTC
TTAGATTCTG ACTGCCTGAT TGCATATTTG TCTGTGCTAC TTCTTTACAT TTTCATGGTA CGCGGTCTGT TCACTCTTTA
ACTATTTATT GCTAGACCGC TTGACGCAGG TATTAGATGC AGAAAGAGAG TCACCCAAAG AATTTCAGCC ATTGCCGTTC
CACTATATTG AAATATCTAA GCTTCTCTTT GATCAGTAAG TATTCATATT TCATAGAAAC TCTTGTAGTA ATTCTATAAT
AAGAATCTGC AAAACTTATT TCTCTCTCTC TATATATATG TGTCAAGTGC TCGTGATGAC ATCTCAGATG CATACCTGGT
GAGTTACAGA AACCTTCGGA AGAAATTTCC ACTGACTAAT TGGCTCTGAT ATTATTTGGA AACAAAATTT TGCTTACTTC
TAGCTGCATG TAGGTAAGAT CTTTGATTGA GGACATCCGA GATGTCAGAT TCCATAAGGT TGAGACTGGT CTGGAGACAA
TATCTGGCCG TACTCATGCT GTAAAGGTAT ATTCTCTCCA CACTATAGCT ACTTTATCTG CCGCTTGTCC TGGCTGCTCA
GATTGTGTTG AAGCTATTCC ATGTGTTATA CCTTTCTTCT ATCTACTGTT TGTAGCATTT ATTTTTTTAA TCAATTTTTT
TTGTAGTGTA TGTAAACTAT AAAACTTAAC CTTTCTCATA AGCATCACTA ACAAATTAAA CATAAAACTC GTCTATTTGT
GATGTCACAC GATTGTGATT GTAAAATGTA AACTGTGTAT GCTTCCATAT TCTTACTCAA TATTTACCAT CAGACTTCTT
AAATTATGAC CCATTATGAT CTTTTTTCCC TGCTTACCTC ATGCACATAT ATATATATAT ATTTGCATTT ATACAGCTAA
AAAATCTCTC TGCAATGGAA GTGAATATCG TGCGTCCTTT CATGGTGAGA ACTTTACAAG CATTCTATAA GCATGATAGC
CCACAGATGA TTCAGCAGGC AGATAACACA GGTAGCAGAC CAACACCAGT TACAGACCGT GGTCCAAGAG TAAGCCTTCA
TTTTTTCCAC ATATGATTTG TTCTCGTTTC CTAGAAAGAG TTGTTTTTTC AATCAAAATT CGCTCTAAGA TGATATATGC
AAATAGTTTC GTACCAACGG TGCATAATAA CTTTCTACTA CATAGAATTC AATCACAAAA AAGATGCTTC TCATTTGTTT
CTTGAAATCA AGCTTCTAAT AACATGTTAT TCATTTCTGC GGTGATATTA TCAATAAACA TTCCTAAATT CCCATCATTT
TTTTTTGCAG AGAGATCTAA GGCGCAGGTA ACAAGCAGGA TGTGTATCTA TCCCTTGAAA ATTTTACTGT GTGTAGATTG
CAGTAAATGA AGGTACTTGT GATCTGTATC TCACTAGCTA GAAGCCAACT GCGTTTCCCC AATTTGTTGT GTGTGTACCA
AAATTTTATA GGACTAATAA CATTTGACAT GGTTTTGTTT TTGAAGAAGC GAAGATAGTA AGATACATCA ATTATCTGTC
ACAAAAGGGA GATTCCTCAT GTATTCTGGA TGGATGTAAC TTATGTGATG TATTTTTACT ATTTCTGGC

Locus: Os01g0248600

Loading...

Locus: Os01g0248600

Loading...